Sunday, 17 December 2017

المتاجرة نظام العمارة الرسم


الهندسة المعمارية لماكس على مدى السنوات القليلة الماضية نواصل سماع أن الغداء مجانا هو over1 - نحن لا يمكن أن نتوقع زيادات في سرعة وحدة المعالجة المركزية الفردية. لذلك لكتابة رمز سريع نحن بحاجة إلى استخدام صراحة معالجات متعددة مع البرمجيات المتزامنة. هذه ليست أخبار جيدة - كتابة رمز المتزامنة من الصعب جدا. الأقفال و سيمافوريس من الصعب أن العقل حول ويصعب اختبار - وهذا يعني أننا ننفق المزيد من الوقت القلق حول إرضاء الكمبيوتر من نحن حل مشكلة المجال. وتهدف نماذج التزامن المختلفة، مثل الممثلين وذاكرة المعاملات البرمجية، إلى جعل هذا الأمر أسهل - ولكن لا يزال هناك عبء يقدم الخلل والتعقيد. لذلك كنت مفتونا لسماع الحديث في كيوكون لندن في مارس من العام الماضي من لماكس. لماكس هو منصة التداول المالي التجزئة الجديدة. الابتكار في مجال الأعمال هو أنه هو منصة التجزئة - السماح لأي شخص للتجارة في مجموعة من المنتجات المشتقة المالية 2. منصة التداول مثل هذا يحتاج الكمون المنخفض جدا - الصفقات يجب معالجتها بسرعة لأن السوق يتحرك بسرعة. وتضيف منصة التجزئة تعقيدا لأنه يجب القيام بذلك لكثير من الناس. وبالتالي فإن النتيجة هي عدد أكبر من المستخدمين، مع الكثير من الصفقات، وكلها تحتاج إلى معالجة بسرعة 3. ونظرا للتحول إلى التفكير متعددة النوى، وهذا النوع من الأداء تطلبا من الطبيعي أن تشير إلى نموذج البرمجة المتزامنة صراحة - وكان هذا في الواقع نقطة البداية. ولكن الشيء الذي حصل على اهتمام الناس في كيوكون كان هذا ليس حيث انتهى بهم المطاف. في الواقع أنها انتهى بها القيام بكل منطق الأعمال لمنصاتهم: جميع الصفقات، من جميع العملاء، في جميع الأسواق - على موضوع واحد. خيط سنقوم بمعالجة 6 مليون طلب في الثانية باستخدام أجهزة السلع .4 معالجة الكثير من المعاملات مع الكمون المنخفض وأي من تعقيدات التعليمات البرمجية المتزامنة - كيف يمكنني مقاومة الحفر إلى ذلك لحسن الحظ اختلاف آخر لماكس له للشركات المالية الأخرى هو أن فهم سعداء جدا للحديث عن قراراتهم التكنولوجية. حتى الآن وقد تم لماكس في الإنتاج لفترة من الوقت وقتها لاستكشاف تصميمها رائعة. الهيكل العام الشكل 1: الهندسة المعمارية لماكس في ثلاث النقط على مستوى أعلى، والهندسة المعمارية ثلاثة أجزاء منطق منطق المعالج 5 المدخلات ديسروبتور الإخراج الناتج كما يوحي اسمها، معالج منطق الأعمال يعالج كل منطق الأعمال في التطبيق. كما أشرت أعلاه، فإنه يفعل هذا كبرنامج جافا ترابط واحد الذي يتفاعل مع يدعو المكالمات وتنتج أحداث الإخراج. وبالتالي برنامج جافا بسيط الذي لا يتطلب أي أطر منصة لتشغيل أخرى من جفم نفسها، والذي يسمح لها أن تكون تشغيلها بسهولة في بيئات الاختبار. على الرغم من أن منطق الأعمال المعالج يمكن تشغيل في بيئة بسيطة للاختبار، وهناك الكوريغرافيا بدلا أكثر تشارك للحصول عليه لتشغيل في إعداد الإنتاج. تحتاج رسائل الإدخال إلى أن يتم إيقاف تشغيلها من بوابة شبكة وغير مقسمة، ومكررة، و جورنالد. ويلزم تنظيم رسائل المخرجات للشبكة. يتم التعامل مع هذه المهام من قبل المخرجات المدخلات والمخرجات. على عكس معالج منطق الأعمال، وهذه هي عناصر متزامنة، لأنها تنطوي على عمليات إو التي هي على حد سواء بطيئة ومستقلة. صممت وصنعت خصيصا ل لماكس، ولكنها (مثل العمارة الشاملة) قابلة للتطبيق في مكان آخر. معالج منطق الأعمال حفظ كل شيء في الذاكرة معالج منطق الأعمال يأخذ رسائل الإدخال بالتتابع (في شكل استدعاء الأسلوب)، ويدير منطق الأعمال على ذلك، وتنبعث أحداث الإخراج. وهي تعمل تماما في الذاكرة، لا توجد قاعدة بيانات أو غيرها من مخزن دائم. حفظ جميع البيانات في الذاكرة اثنين من الفوائد الهامة. أولا لها سريع - ثيريس أي قاعدة بيانات لتوفير إو بطيئة للوصول، كما لا يوجد أي سلوك المعاملات لتنفيذ منذ يتم كل معالجة بالتتابع. والميزة الثانية هي أنه يبسط البرمجة - ثيريس لا رسم الخرائط أوبجكتريلاتيونال القيام به. يمكن كتابة كافة التعليمات البرمجية باستخدام نموذج كائن جافا دون الحاجة إلى تقديم أي تنازلات لرسم الخرائط إلى قاعدة بيانات. استخدام بنية في الذاكرة له نتيجة مهمة - ماذا يحدث إذا تعطل كل شيء حتى النظم الأكثر مرونة هي عرضة لشخص سحب القوة. قلب التعامل مع هذا هو مصادر الحدث - وهو ما يعني أن الحالة الراهنة من منطق منطق المعالج هو مشتق تماما من خلال معالجة الأحداث المدخلات. طالما يتم الاحتفاظ تيار الحدث المدخلات في مخزن دائم (الذي هو واحد من الوظائف من تعطيل ديسروبتور) يمكنك دائما إعادة الحالة الراهنة لمحرك منطق الأعمال عن طريق إعادة الأحداث. وهناك طريقة جيدة لفهم هذا هو التفكير في نظام التحكم في الإصدار. أنظمة التحكم في النسخة هي سلسلة من الإلتزامات، في أي وقت يمكنك بناء نسخة عمل بتطبيق تلك الالتزامات. فس أكثر تعقيدا من منطق منطق المعالج لأنه يجب دعم المتفرعة، في حين أن منطق منطق المعالج هو تسلسل بسيط. لذلك، من الناحية النظرية، يمكنك دائما إعادة بناء حالة المعالج منطق الأعمال عن طريق إعادة معالجة جميع الأحداث. في الممارسة العملية، ومع ذلك، فإن ذلك سوف يستغرق وقتا طويلا إذا كنت بحاجة إلى تدور واحدة تصل. لذلك، تماما كما هو الحال مع أنظمة التحكم الإصدار، يمكن لماكس جعل لقطات من حالة منطق منطق الأعمال واستعادة من لقطات. أنها تأخذ لقطة كل ليلة خلال فترات النشاط المنخفض. إعادة تشغيل "منطق المنطق المعالج" سريع، إعادة التشغيل الكامل - بما في ذلك إعادة تشغيل جفم، تحميل لقطة الأخيرة، واعادتها قيمة أيام من المجلات - يستغرق أقل من دقيقة. لقطات تجعل بدء جديد منطق منطق المعالج أسرع، ولكن ليس بسرعة كافية يجب تحطم منطق منطق الأعمال في 2pm. ونتيجة لماكس يحافظ على متعددة منطق منطق المعالجات تشغيل كل time6. تتم معالجة كل حدث الإدخال من قبل معالجات متعددة، ولكن كل معالج واحد ولكن لديها الإخراج تجاهلها. في حالة فشل المعالج المباشر، يتحول النظام إلى جهاز آخر. هذه القدرة على التعامل مع الفشل عبر هو فائدة أخرى من استخدام مصادر الحدث. من خلال مصادر مصادر في النسخ المتماثلة يمكن التبديل بين المعالجات في مسألة الدقيقة ثانية. فضلا عن أخذ لقطات كل ليلة، فإنها أيضا إعادة تشغيل منطق منطق المعالجات كل ليلة. النسخ المتماثل يسمح لهم للقيام بذلك مع أي وقت التوقف عن العمل، حتى أنها لا تزال في التعامل مع الصفقات 247. لمزيد من الخلفية على إيفنت سورسينغ، راجع مشروع النموذج على موقعي منذ بضع سنوات. المادة هي أكثر تركيزا على التعامل مع العلاقات الزمنية بدلا من الفوائد التي استخدام لماكس، لكنه لا يفسر الفكرة الأساسية. مصدر الحدث هو قيمة لأنه يسمح المعالج لتشغيل تماما في الذاكرة، ولكن لديه ميزة كبيرة أخرى للتشخيص. في حالة حدوث بعض السلوك غير المتوقع، يقوم الفريق بنسخ تسلسل الأحداث إلى بيئتهم التطويرية واعادتها هناك. وهذا يسمح لهم بفحص ما حدث بسهولة أكبر مما هو ممكن في معظم البيئات. وتمتد هذه القدرة التشخيصية لتشخيص الأعمال. هناك بعض المهام التجارية، مثل إدارة المخاطر، التي تتطلب حساب كبير لا حاجة لمعالجة الطلبات. ومن الأمثلة على ذلك الحصول على قائمة بأهم 20 عميلا من خلال بيان المخاطر استنادا إلى مراكز التداول الحالية. يتعامل الفريق مع ذلك من خلال تدور نموذج نطاق مكرر وإجراء الحساب هناك، حيث لن يتداخل مع معالجة النظام الأساسي. يمكن أن يكون لنماذج تحليل البيانات هذه نماذج بيانات بديلة، وأن تبقي مجموعات بيانات مختلفة في الذاكرة، وأن تعمل على أجهزة مختلفة. ضبط الأداء حتى الآن أوضح إيف أن المفتاح لسرعة منطق منطق المعالج يفعل كل شيء بالتتابع، في الذاكرة. مجرد القيام بذلك (ولا شيء حقا غبي) يسمح للمطورين لكتابة التعليمات البرمجية التي يمكن معالجة 10K TPS7. ثم وجدوا أن التركيز على عناصر بسيطة من شفرة جيدة يمكن أن يحقق هذا في نطاق 100K تبس. هذا يحتاج فقط رمز فاكتوريد جيدا والأساليب الصغيرة - وهذا أساسا يسمح هوت سبوت للقيام بعمل أفضل من التحسين و لوحدات المعالجة المركزية لتكون أكثر كفاءة في التخزين المؤقت رمز تشغيله. استغرق الأمر المزيد من الذكاء قليلا لترتفع ترتيب آخر من حيث الحجم. هناك العديد من الأشياء التي وجد فريق لماكس مفيدة للوصول إلى هناك. واحد كان لكتابة تطبيقات مخصصة من مجموعات جافا التي تم تصميمها لتكون صديقة للتخزين المؤقت والحذر مع القمامة 8. مثال على ذلك هو استخدام جافا البدائية الأطوال مفاتيح هاشماب مع مجموعة مكتوبة خصيصا بدعم خريطة تنفيذ (لونغتوبجيكاشماب). وبصفة عامة وجدوا أن اختيار هياكل البيانات غالبا ما يحدث فرقا كبيرا، ومعظم المبرمجين مجرد الاستيلاء على أي قائمة كانوا يستخدمون في المرة الأخيرة بدلا من التفكير في التنفيذ هو الصحيح واحد لهذا السياق .9 تقنية أخرى للوصول إلى هذا المستوى الأعلى من الأداء يضع الاهتمام في اختبار الأداء. لقد لاحظت منذ فترة طويلة أن الناس يتحدثون كثيرا عن تقنيات لتحسين الأداء، ولكن الشيء الوحيد الذي يحدث فرقا حقا هو لاختبار ذلك. حتى المبرمجين الجيدين جيد جدا في بناء الحجج الأداء التي في نهاية المطاف يجري الخطأ، وبالتالي فإن أفضل المبرمجين يفضلون الدارسين وحالات الاختبار للمضاربة. 10 وقد وجد فريق لماكس أيضا أن كتابة الاختبارات أولا هو الانضباط الفعال جدا لاختبارات الأداء. نموذج البرمجة هذا النمط من المعالجة لا يعرض بعض القيود في طريقة كتابة وتنظيم منطق الأعمال. الأول من هذه هي أن لديك أي ندف أي التفاعل مع الخدمات الخارجية. ستكون مكالمة خدمة خارجية بطيئة، ومع وجود مؤشر ترابط واحد سيوقف آلة معالجة الطلب بأكملها. ونتيجة لذلك لا يمكنك إجراء مكالمات إلى الخدمات الخارجية ضمن منطق الأعمال. بدلا من ذلك تحتاج إلى إنهاء هذا التفاعل مع حدث الإخراج، وانتظر حدث إدخال آخر لاستعادته مرة أخرى. سوء استخدام مثال بسيط غير لماكس لتوضيح. تخيل أنك جعل النظام ل هلام الفول عن طريق بطاقة الائتمان. نظام البيع بالتجزئة بسيط من شأنه أن يأخذ معلومات طلبك، واستخدام خدمة التحقق من صحة بطاقة الائتمان للتحقق من رقم بطاقة الائتمان الخاصة بك، ومن ثم تأكيد طلبك - كل ذلك في إطار عملية واحدة. معالجة مؤشر الترابط الخاص بك سيتم حظر أثناء انتظار بطاقة الائتمان إلى أن يتم التحقق، ولكن هذه الكتلة لن تكون طويلة جدا للمستخدم، والخادم يمكن دائما تشغيل مؤشر ترابط آخر على المعالج أثناء انتظاره. في الهندسة المعمارية لماكس، يمكنك تقسيم هذه العملية إلى اثنين. العملية الأولى سوف التقاط المعلومات النظام والانتهاء عن طريق إخراج الحدث (التحقق من صحة بطاقة الائتمان المطلوبة) لشركة بطاقة الائتمان. ومن ثم سيعمل "معالج منطق الأعمال" على معالجة الأحداث للعملاء الآخرين حتى يحصل على حدث التحقق من بطاقة الائتمان في تيار الحدث المدخلات. عند معالجة هذا الحدث فإنه سيتم تنفيذ مهام التأكيد لهذا الطلب. العمل في هذا النوع من نمط يحركها الحدث، غير متزامن، هو غير عادي إلى حد ما - على الرغم من أن استخدام عدم التزامن لتحسين استجابة التطبيق هو أسلوب مألوف. كما أنه يساعد عملية الأعمال تكون أكثر مرونة، كما يجب أن تكون أكثر وضوحا في التفكير في الأشياء المختلفة التي يمكن أن يحدث مع التطبيق البعيد. وهناك سمة ثانية لنموذج البرمجة تكمن في معالجة الأخطاء. النموذج التقليدي للجلسات والمعاملات قاعدة البيانات يوفر قدرة معالجة الخطأ مفيدة. إذا كان أي شيء على غير ما يرام، من السهل أن رمي بعيدا كل ما حدث حتى الآن في التفاعل. بيانات الدورة عابرة، ويمكن التخلص منها، على حساب بعض تهيج للمستخدم إذا كان في منتصف شيء معقد. إذا حدث خطأ على جانب قاعدة البيانات يمكنك التراجع عن المعاملة. هياكل لماكس في الذاكرة هي مستمرة عبر أحداث الإدخال، لذلك إذا كان هناك خطأ من المهم أن لا تترك تلك الذاكرة في حالة غير متناسقة. ومع ذلك ثيريس لا منشأة التراجع الآلي. ونتيجة لذلك يضع فريق لماكس الكثير من الاهتمام في ضمان الأحداث المدخلات صالحة تماما قبل القيام بأي طفرة في حالة ثابتة في الذاكرة. وقد وجدوا أن الاختبار هو أداة رئيسية في إزالة هذه المشاكل قبل الدخول إلى الإنتاج. المدخلات والمخرجات تعطيل على الرغم من أن منطق الأعمال يحدث في مؤشر ترابط واحد، هناك عدد المهام التي يتعين القيام به قبل أن نتمكن من استدعاء أسلوب عنصر الأعمال. المدخل الأصلي للتجهيز يأتي من السلك في شكل رسالة، يجب أن تكون هذه الرسالة غير مقننة في شكل مناسب ل منطق الأعمال المعالج لاستخدامها. يعتمد إيفنت سورسينغ على الحفاظ على مجلة دائمة لجميع الأحداث المدخلات، لذلك كل رسالة إدخال يحتاج إلى أن يكون دفتر اليومية على متجر دائم. وأخيرا تعتمد الهندسة المعمارية على مجموعة من معالجات منطق الأعمال، لذلك علينا أن نكرر رسائل الإدخال عبر هذه المجموعة. وبالمثل على جانب المخرجات، يتعين تنظيم أحداث الإخراج للإرسال عبر الشبكة. الشكل 2: الأنشطة التي قام بها مضطرب المدخلات (باستخدام أومل النشاط الرسم التخطيطي تدوين) المكرر و جورنالر تنطوي إو، وبالتالي بطيئة نسبيا. بعد كل الفكرة المركزية من منطق منطق المعالج هو أنه يتجنب القيام أي إو. أيضا هذه المهام الثلاث مستقلة نسبيا، كل منهم تحتاج إلى القيام به قبل الأعمال منطق المنطق يعمل على رسالة، ولكن يمكن القيام به في أي أمر. لذلك على خلاف مع منطق منطق المعالج، حيث كل التجارة يغير السوق لحركات لاحقة، هناك تناسب الطبيعي لالتزامن. للتعامل مع هذا التزامن قام فريق لماكس بتطوير مكون التزامن خاص، الذي يطلق عليه ديسروبتور 11. وقد أصدر فريق لماكس شفرة المصدر لل ديسروبتور مع رخصة مفتوحة المصدر. على مستوى الخام يمكن أن نفكر في ديسروبتور كرسم بياني المتعدد من طوابير حيث وضع المنتجين الكائنات على أن يتم إرسالها إلى جميع المستهلكين للاستهلاك الموازي من خلال طوابير المصب منفصلة. عندما تنظر في الداخل ترى أن هذه الشبكة من طوابير هو في الحقيقة بنية بيانات واحدة - المخزن المؤقت الدائري. كل منتج ومستهلك لديه عداد تسلسل للإشارة إلى أي فتحة في المخزن المؤقت الذي يعمل حاليا على. كل برودوسركونسومر يكتب عداد تسلسل الخاصة به ولكن يمكن قراءة عدادات تسلسل الآخرين. بهذه الطريقة يمكن للمنتج قراءة عدادات المستهلكين لضمان فتحة يريد أن يكتب في متاح دون أي أقفال على العدادات. وبالمثل يمكن للمستهلك أن يضمن أنه يعالج الرسائل فقط مرة واحدة يتم المستهلك الآخر معها من خلال مشاهدة العدادات. الشكل 3: تعطل المدخلات ينسق منتج واحد وأربعة مستهلكين مشابهات الإخراج متشابهة ولكن ليس لديهم سوى مستهلكين متتابعين للتنظيم والإخراج (12). وتنظم أحداث الإخراج في عدة مواضيع، بحيث يمكن إرسال الرسائل إلى المستقبلين المهتمين فقط فيهم. كل موضوع ديسروبتور الخاصة بها. وتستخدم المعطلين إيف وصفها في نمط مع منتج واحد ومتعددة المستهلكين، ولكن هذا ليس حد من تصميم ديسروبتور. يمكن أن يعمل المعطل مع العديد من المنتجين أيضا، في هذه الحالة فإنه لا يزال لا يحتاج الأقفال. 13 فائدة من تصميم ديسروبتور هو أنه يجعل من الأسهل بالنسبة للمستهلكين للحاق بسرعة إذا واجهت مشكلة وتتخلف. إذا كان لدى المشكل مشكلة عند المعالجة على الفتحة 15 وتعود عندما يكون المستقبل على الفتحة 31، يمكنه قراءة البيانات من الفواصل الزمنية 16-30 في دفعة واحدة للحاق بالركب. هذه القراءة دفعة من البيانات من ديسروبتور يجعل من السهل على المستهلكين المتخلفة للحاق بسرعة، وبالتالي تقليل الكمون العام. لقد وصفت أشياء هنا، مع كل واحد من جورنالر، المكرر، ونمارشالر - هذا هو في الواقع ما لاكس يفعل. لكن التصميم سيسمح بتشغيل العديد من هذه المكونات. إذا قمت بتشغيل اثنين من الصحفيين ثم واحد سوف تأخذ الفواصل حتى و جورنالر الأخرى سوف تأخذ فتحات غريبة. ويتيح ذلك المزيد من التزامن عمليات إو هذه إذا ما أصبح ذلك ضروريا. المخازن المؤقتة حلقة كبيرة: 20 مليون فتحات العازلة المدخلات و 4 ملايين فتحات لكل من مخازن الإخراج. عدادات تسلسل هي 64 بت طويلة الأعداد الصحيحة التي تزيد مونوتونيكالي حتى كما حلقة فتحات التفاف. 14 يتم تعيين المخزن المؤقت إلى حجم الذي هو قوة اثنين بحيث يمكن للمترجم إجراء عملية معامل فعالة لتعيين من رقم عداد تسلسل إلى رقم الفتحة . ومثل بقية النظام، ارتدت الاضطرابات بين عشية وضحاها. ويتم هذا الارتداد أساسا للقضاء الذاكرة بحيث هناك فرصة أقل من الحدث جمع القمامة باهظة الثمن خلال التداول. (وأعتقد أيضا أنها عادة جيدة لإعادة تشغيل بانتظام، بحيث يمكنك تكرار كيفية القيام بذلك لحالات الطوارئ). وظيفة جورنالرز هو لتخزين جميع الأحداث في شكل دائم، بحيث يمكن أن يعادوا إذا كان أي شيء على ما يرام. لاكس لا تستخدم قاعدة بيانات لهذا، مجرد نظام الملفات. أنها تيار الأحداث على القرص. من الناحية الحديثة، الأقراص الميكانيكية بطيئة بشكل فظيع للوصول العشوائي، ولكن سريع جدا لتدفق - وبالتالي القرص خط العلامة هو الشريط الجديد. 15 في وقت سابق على ذكر أن لماكس يدير نسخ متعددة من نظامها في مجموعة لدعم الفشل السريع . يحتفظ المكرر هذه العقد متزامنة. جميع الاتصالات في لماكس يستخدم إب المتعدد، لذلك العملاء لا تحتاج إلى معرفة أي عنوان إب هو العقدة الرئيسية. فقط العقدة الرئيسية تستمع مباشرة إلى أحداث الإدخال وتشغيل نسخة متماثلة. يبث المكرر أحداث الإدخال لعقد الرقيق. إذا كانت العقدة الرئيسية تنخفض، سيتم ملاحظة عدم وجود ضربات القلب، عقدة أخرى يصبح سيد، يبدأ معالجة أحداث الإدخال، ويبدأ النسخ المتماثل. كل عقدة لديها ديسروبتور المدخلات الخاصة بها، وبالتالي لديها مجلة خاصة بها ولا يفعله غير النمطية الخاصة بها. وحتى مع تعدد الإرسال إب، لا تزال هناك حاجة إلى النسخ المتماثل لأن رسائل بروتوكول الإنترنت يمكن أن تصل إلى ترتيب مختلف على عقد مختلفة. توفر العقدة الرئيسية تسلسل حتمي لبقية المعالجة. يحول أونمارشالر بيانات الحدث من السلك إلى كائن جافا التي يمكن استخدامها لاستدعاء السلوك على "معالج منطق الأعمال". لذلك، خلافا للمستهلكين الآخرين، فإنه يحتاج إلى تعديل البيانات في المخزن المؤقت الدائري بحيث يمكن تخزين هذا الكائن أونمارشاليد. القاعدة هنا هي أنه يسمح للمستهلكين بالكتابة إلى المخزن المؤقت الدائري، ولكن يمكن لكل حقل قابل للكتابة أن يكون لديه مستهلك مواز واحد يسمح له بالكتابة إليه. وهذا يحافظ على مبدأ وجود كاتب واحد فقط. 16 الشكل 4: العمارة لماكس مع الاضطرابات الموسعة ديسروبتور هو مكون للأغراض العامة التي يمكن استخدامها خارج نظام لماكس. عادة ما تكون الشركات المالية سرية للغاية حول أنظمتها، والحفاظ على الهدوء حتى عن العناصر التي أرينت مرتبطة بأعمالهم. ليس فقط لمكس كان مفتوحا حول العمارة الشاملة، لديهم مفتوحة المصدر رمز ديسروبتور - وهو عمل يجعلني سعيدا جدا. ليس فقط سوف يسمح هذا للمنظمات الأخرى الاستفادة من ديسروبتور، وسوف تسمح أيضا لمزيد من اختبار خصائص التزامن. الطوابير وانعدام التعاطف الميكانيكي اشتهرت الهندسة المعمارية لماكس اهتمام الناس لأنها طريقة مختلفة جدا من الاقتراب من نظام عالي الأداء لما يفكر فيه معظم الناس. حتى الآن تحدث إيف عن كيفية عمله، ولكن خافت دافع كثيرا في لماذا تم تطويره بهذه الطريقة. هذه القصة مثيرة للاهتمام في حد ذاتها، لأن هذا العمارة لم تظهر فقط. استغرق الأمر وقتا طويلا في محاولة بدائل أكثر تقليدية، وإدراك حيث كانت معيبة، قبل أن يستقر الفريق على هذا واحد. معظم أنظمة الأعمال في هذه الأيام لديها بنية أساسية تعتمد على جلسات نشطة متعددة منسقة من خلال قاعدة بيانات المعاملات. وكان فريق لماكس على دراية بهذا النهج، واثقة من أنها لن تعمل لماكس. وقد تم تأسيس هذا التقييم في تجارب بيتفير - الشركة الأم التي أنشأت لماكس. بيتفير هو موقع الرهان الذي يسمح للناس للمراهنة على الأحداث الرياضية. فهو يعالج كميات كبيرة جدا من حركة المرور مع الكثير من الخلاف - الرهانات الرياضية تميل إلى انفجار حول أحداث معينة. لجعل هذا العمل لديهم واحدة من أهم المنشآت قاعدة البيانات في جميع أنحاء وكان عليها أن تفعل العديد من الأعمال غير طبيعية من أجل جعلها تعمل. واستنادا إلى هذه التجربة كانوا يعرفون مدى صعوبة الحفاظ على أداء بيتفايرس وكانوا على يقين من أن هذا النوع من العمارة لن يعمل من أجل الكمون المنخفض جدا الذي يتطلبه موقع تجاري. ونتيجة لذلك كان عليهم أن يجدوا نهجا مختلفا. كان نهجهم الأولي لمتابعة ما يقوله الكثيرون في هذه الأيام - أن للحصول على الأداء العالي تحتاج إلى استخدام التزامن صريح. بالنسبة لهذا السيناريو، يعني هذا السماح بالطلبات التي سيتم معالجتها بواسطة سلاسل عمليات متعددة بالتوازي. ومع ذلك، كما هو الحال في كثير من الأحيان مع التزامن، تأتي صعوبة لأن هذه المواضيع يجب أن التواصل مع بعضها البعض. معالجة أمر تغيير ظروف السوق وهذه الشروط تحتاج إلى أن يتم إبلاغ. وكان النهج الذي استكشفه في وقت مبكر نموذج الممثل وابن عمه سيدا. يعتمد نموذج الممثل على كائنات مستقلة، نشطة مع خيط الخاصة بهم التي تتصل مع بعضها البعض عبر طوابير. كثير من الناس يجدون هذا النوع من نموذج التزامن أسهل بكثير للتعامل مع من محاولة القيام بشيء على أساس تأمين الأوليات. وقد قام الفريق ببناء نموذج نموذجي باستخدام نموذج الممثل وفعل اختبارات الأداء عليه. ما وجدوه هو أن المعالجات قضى المزيد من الوقت إدارة قوائم الانتظار من القيام المنطق الحقيقي للتطبيق. كان الوصول إلى قائمة الانتظار عنق الزجاجة. عند دفع الأداء من هذا القبيل، فإنه يصبح من المهم أن تأخذ في الاعتبار الطريقة التي يتم بناؤها الأجهزة الحديثة. عبارة مارتن طومسون يحب استخدام التعاطف الميكانيكي. هذا المصطلح يأتي من سباق السيارات القيادة ويعكس السائق وجود شعور فطري للسيارة، لذلك هم قادرون على الشعور كيفية الحصول على أفضل للخروج منه. العديد من المبرمجين، وأنا أعترف أنني تقع في هذا المخيم، ليس لديهم الكثير من التعاطف الميكانيكية لكيفية البرمجة تتفاعل مع الأجهزة. ما هو أسوأ من ذلك أن العديد من المبرمجين يعتقدون أن لديهم التعاطف الميكانيكية، ولكن بنيت على مفاهيم كيف الأجهزة المستخدمة في العمل التي هي الآن سنوات عديدة من التاريخ. واحدة من العوامل المهيمنة مع وحدات المعالجة المركزية الحديثة التي تؤثر على الكمون، هو كيف تتفاعل وحدة المعالجة المركزية مع الذاكرة. هذه الأيام الذهاب إلى الذاكرة الرئيسية هي عملية بطيئة جدا في وحدة المعالجة المركزية شروط. وحدات المعالجة المركزية لديها مستويات متعددة من ذاكرة التخزين المؤقت، كل منها هو أسرع بكثير. لذلك لزيادة السرعة التي تريد الحصول على التعليمات البرمجية والبيانات في تلك المخابئ. على مستوى واحد، نموذج الممثل يساعد هنا. يمكنك التفكير في الفاعل ككائن الخاصة التي تتجمع التعليمات البرمجية والبيانات، التي هي وحدة طبيعية للتخزين المؤقت. ولكن الجهات الفاعلة تحتاج إلى التواصل، والتي تفعل من خلال طوابير - ولاحظ فريق لماكس أن طوابير التي تتداخل مع التخزين المؤقت. تفسير يعمل مثل هذا: من أجل وضع بعض البيانات على قائمة الانتظار، تحتاج إلى الكتابة إلى قائمة الانتظار هذه. وبالمثل، لأخذ البيانات من قائمة الانتظار، تحتاج إلى الكتابة إلى قائمة الانتظار لتنفيذ الإزالة. هذا هو الكتابة الخلاف - أكثر من عميل واحد قد تحتاج إلى الكتابة إلى بنية البيانات نفسها. للتعامل مع الكتابة الخلاف طابور غالبا ما تستخدم الأقفال. ولكن إذا تم استخدام قفل، يمكن أن يؤدي إلى تبديل السياق إلى النواة. عندما يحدث هذا المعالج من المرجح أن تفقد البيانات في مخابئ لها. الاستنتاج الذي جاءوا إليه هو أن للحصول على أفضل سلوك التخزين المؤقت، تحتاج إلى تصميم يحتوي على واحد فقط الكتابة الأساسية إلى أي مكان الذاكرة 17. القراء متعددة على ما يرام، والمعالجات غالبا ما تستخدم روابط عالية السرعة الخاصة بين مخابئ الخاصة بهم. ولكن طوابير تفشل مبدأ الكاتب واحد. قاد هذا التحليل فريق لماكس إلى استنتاجين. أولا أنها أدت إلى تصميم ديسروبتور، الذي يتبع بحزم القيد واحد الكاتب. وثانيا أدى إلى فكرة استكشاف نهج منطق الأعمال مترابطة واحد، يسأل عن مدى سرعة خيط واحد يمكن أن تذهب إذا كان تحريرها من إدارة التزامن. جوهر العمل على موضوع واحد، هو التأكد من أن لديك موضوع واحد يعمل على جوهر واحد، مخابئ الاحماء، والوصول إلى الذاكرة قدر الإمكان يذهب إلى مخابئ بدلا من الذاكرة الرئيسية. وهذا يعني أن كل من الشفرة ومجموعة العمل يجب أن تكون على النحو المتواصل. أيضا حفظ الكائنات الصغيرة مع التعليمات البرمجية والبيانات معا يسمح لهم لتبادلها بين مخابئ كوحدة، وتبسيط إدارة ذاكرة التخزين المؤقت ومرة ​​أخرى تحسين الأداء. وكان جزء أساسي من المسار إلى العمارة لماكس استخدام اختبار الأداء. وکان النظر في النهج القائم علی الفاعلین والتخلي عنھ من بناء واختبار الأداء نموذجا أولیا. وبالمثل، تم إجراء الكثير من الخطوات في تحسين أداء المكونات المختلفة من خلال اختبارات الأداء. التعاطف الميكانيكي هو قيمة جدا - فإنه يساعد على تشكيل فرضيات حول ما التحسينات التي يمكن أن تجعل، ويرشدك إلى إعادة توجيه الخطوات بدلا من الخلف - ولكن في نهاية الاختبار يعطي لك أدلة مقنعة. ومع ذلك، فإن اختبار الأداء في هذا النمط ليس موضوعا مفهوما جيدا. بانتظام فريق لماكس يؤكد أن الخروج مع اختبارات الأداء ذات مغزى غالبا ما يكون أصعب من تطوير رمز الإنتاج. مرة أخرى التعاطف الميكانيكية مهم لتطوير الاختبارات الصحيحة. اختبار مكون التزامن منخفض المستوى لا معنى له إلا إذا كنت تأخذ في الاعتبار سلوك التخزين المؤقت لوحدة المعالجة المركزية. درس معين هو أهمية كتابة الاختبارات ضد مكونات فارغة لضمان اختبار الأداء سريع بما فيه الكفاية لقياس حقا ما المكونات الحقيقية تقوم به. كتابة رمز الاختبار السريع ليس أسهل من كتابة رمز الإنتاج السريع و من السهل جدا للحصول على نتائج كاذبة لأن الاختبار ليس بأسرع المكون الذي تحاول قياسه. يجب عليك استخدام هذه العمارة للوهلة الأولى، يبدو أن هذه العمارة لتكون صغيرة جدا. بعد كل السائق الذي أدى إلى أنه كان قادرا على تشغيل الكثير من المعاملات المعقدة مع الكمون المنخفض جدا - معظم التطبيقات لا تحتاج إلى تشغيل في 6 ملايين تبس. ولكن الشيء الذي يفتخر لي حول هذا التطبيق، هو أنها قد انتهى مع التصميم الذي يزيل الكثير من تعقيد البرمجة التي تعاني العديد من مشاريع البرمجيات. النموذج التقليدي من الجلسات المتزامنة المحيطة قاعدة بيانات المعاملات ليست خالية من المتاعب. ثريس عادة جهد غير تافهة الذي يذهب إلى العلاقة مع قاعدة البيانات. أدوات رسم الخرائط أوبجكتيراتيونال يمكن أن تساعد كثيرا من ألم التعامل مع قاعدة بيانات، لكنها لا تتعامل مع كل شيء. معظم ضبط الأداء من تطبيقات المؤسسة ينطوي فوتزينغ حولها مع سكل. في هذه الأيام، يمكنك الحصول على المزيد من الذاكرة الرئيسية في الخوادم الخاصة بك مما يمكن لنا الرجال القديمة الحصول على مساحة القرص. المزيد والمزيد من التطبيقات هي قادرة تماما على وضع كل مجموعة عملهم في الذاكرة الرئيسية - وبالتالي القضاء على مصدر كل من التعقيد والبطء. يوفر الحدث مصادر وسيلة لحل مشكلة المتانة لنظام في الذاكرة، تشغيل كل شيء في موضوع واحد يحل مشكلة التزامن. تجربة لماكس تشير إلى أنه طالما كنت بحاجة إلى أقل من بضعة ملايين تبس، سيكون لديك ما يكفي من الأداء الارتفاع. هناك تداخل كبير هنا مع الاهتمام المتزايد في ككرس. الحدث مصدرها، في الذاكرة المعالج هو خيار طبيعي للجانب الأوامر من نظام كرس. (على الرغم من أن فريق لماكس لا يستخدم حاليا سكرس). لذلك ما يدل على أنك لا ينبغي أن تنخفض هذا المسار هذا هو دائما أسئلة صعبة للأساليب غير معروفة مثل هذا، منذ مهنة يحتاج الى مزيد من الوقت لاستكشاف حدوده. ولكن نقطة البداية هي التفكير في الخصائص التي تشجع على الهندسة المعمارية. أحد السمات المميزة هو أن هذا المجال متصل حيث معالجة معاملة واحدة لديها دائما القدرة على تغيير كيفية معالجة التالية. مع المعاملات التي هي أكثر استقلالية عن بعضها البعض، ثيريس أقل حاجة إلى التنسيق، وذلك باستخدام المعالجات منفصلة تعمل في موازاة يصبح أكثر جاذبية. يركز لماكس على معرفة عواقب كيف تغير الأحداث العالم. العديد من المواقع هي أكثر حول اتخاذ مخزن القائمة من المعلومات وتقديم مجموعات مختلفة من تلك المعلومات إلى العديد من مقل العيون كما يمكن أن تجد - على سبيل المثال التفكير في أي موقع وسائل الإعلام. هنا التحدي المعماري غالبا ما يركز على الحصول على مخابئ الخاصة بك الحق. سمة أخرى من لماكس هو أن هذا هو نظام الخلفية، لذلك من المعقول النظر في مدى قابلية للتطبيق على شيء يعمل في وضع تفاعلي. ويساعدنا تطبيق الويب بشكل متزايد على التعود على أنظمة الخادم التي تتفاعل مع الطلبات، وهو جانب لا يتلاءم بشكل جيد مع هذه البنية. حيث يذهب هذا العمارة أبعد من معظم هذه الأنظمة هو استخدامه المطلق للاتصالات غير المتزامنة، مما أدى إلى تغييرات على نموذج البرمجة التي أوضحت سابقا. وستستغرق هذه التغييرات بعض التعود على معظم الفرق. معظم الناس يميلون إلى التفكير في البرمجة في شروط متزامنة ولا تستخدم للتعامل مع أسينكروني. ومع ذلك، فمن الطبيعي أن يكون التواصل غير المتزامن أداة أساسية للاستجابة. سيكون من المثير للاهتمام معرفة ما إذا كان الاستخدام الأوسع للاتصالات غير المتزامنة في عالم جافا سكريبت، مع أجاكس و node. js، سيشجع المزيد من الأشخاص على التحقيق في هذا النمط. ووجد فريق لمكس أنه في حين استغرق قليلا من الوقت للتكيف مع نمط غير متزامن، سرعان ما أصبحت طبيعية وغالبا ما تكون أسهل. كان التعامل مع الأخطاء بشكل خاص أسهل بكثير للتعامل مع هذا النهج. فريق لماكس يشعر بالتأكيد أن أيام قاعدة بيانات المعاملات التنسيق مرقمة. حقيقة أن يمكنك كتابة البرامج بسهولة أكبر باستخدام هذا النوع من الهندسة المعمارية وأنه يعمل بسرعة أكبر يزيل الكثير من التبرير لقاعدة البيانات المركزية التقليدية. من جهتي، أجد هذه قصة مثيرة جدا. الكثير من هدفي هو التركيز على البرمجيات التي نماذج المجالات المعقدة. الهندسة المعمارية مثل هذا يوفر فصل جيد من المخاوف، مما يسمح للناس للتركيز على تصميم يحركها المجال والحفاظ على الكثير من تعقيد منصة فصل جيدا. وكان اقتران وثيقة بين كائنات المجال وقواعد البيانات دائما تهيج - نهج مثل هذا يشير إلى وسيلة للخروج. إذا وجدت هذه المقالة مفيدة، يرجى تقاسمها. أنا أقدر ردود الفعل والتشجيع الرياضيات في العمارة - بويربوانت بت عرض النص ومقدمي ملاحظات عنوان: الرياضيات في العمارة 1 الرياضيات في العمارة ويكرس هذا العرض بأكمله لكيفية تناسب الرياضيات في العمارة. 2 تاريخ الرياضيات في العمارة في العصور القديمة كان العمارة مجالا للرياضيات. وكان المهندسون المعماريون ببساطة الرياضياتيين أن شخص ما سوف استئجار. تم ذكر العمارة للمرة الأولى في النص، كان عن الأهرامات المصرية. هناك رقم ذهبي في العمارة (الجذر 1square من 5) 21.618033989 (1.618033989) 51degrees 50 دقيقة، وتستند الأهرامات المصرية على هذا العدد. نحن لا نعرف ما إذا كانت المحاكمة والخطأ أو إذا كان قد اكتشف بالفعل العدد الذهبي. 3 فيثاغورس كان فيثاغورس واحدة من أقدم التأثيرات على الهندسة المعمارية. كان للأرقام في ثقافتهم أهمية دينية. أخذت فيثاغورس نظرية الموسيقى الأساسية (التي خلقوها) وهي الأصوات سلسلة يعتمد على طوله، ما أدى هذا إلى طول الوحدة الأساسية لهياكل البناء. 4 Where math fits in Every building is measured and level which involves very basic math, In more complex buildings, for an example the Eiffel tower, it needed to be a perfect triangle and have its special curves at a special angle. Also it weighs many tons so it needed to be able to support its own weight. As you can see there are many different types of math needed, which include trigonometry basic measurements proportion and complex multiplications. 5 Obstacles solved with math In Asia there is a building that is very tall and was in danger of earthquakes. They decided to put a giant pendulum in the tower to keep it from tipping or losing its stability. Many buildings are aerodynamically designed so decrease air drag, so that they dont sway too much causing uncomfort or sickness to the people in them, or in very serious cases failure of the building structure. 6 Modern Architecture In the modern era, there is much less calculation done by people. It is all done with computer programming. It could be as simple to bringing the building up to scale, or even to find out how many diamond shaped pieces you needs for a certain area on the building. Computer programming allows us to be much more precise in the work that needs to be done, and also puts a lot less stress on the designer. 7 Activity I will make groups of three or four for this activity. There are so many building shapes youll be given and you have to make the most aerodynamicstructur ally secure building you can make. 8 Questions What is the angle of the pyramids (among many modern buildings). This angle is used to find a certain number Why must skyscrapers be aerodynamic What significance did numbers have for the Pythagoras Why do we now use computers for architecture as a planning tool 9 Answers The angle is 50 degrees and 51 minutes. Skyscrapers are aerodynamic to avoid rocking back and forth or maybe even structural damage. The significance is it represented religious beliefs. We use computers because its much more precise, less time consuming and less room for human error. 10 Bibliography gap. system. org-historyHistTopicsArchitectur e. html Semptember 8th 2009 wwwplus. math. orgissue42featuresfrostersinde x. html September 8th 2009 boelgen vejile. dk October 5th 2009 Cache. ebebimageid75854rendType4 October 5th 2009 your-info-hubguitarratateimage. php October 5th 2009 delhivewarminaryanakshardham-temple0 October 5th 2009 PowerShow is a leading presentationslideshow sharing website. سواء كان التطبيق الخاص بك هو الأعمال التجارية، كيف، والتعليم، والطب، والمدرسة، والكنيسة، والمبيعات، والتسويق، والتدريب عبر الإنترنت أو لمجرد التسلية، بويرشو هو مورد كبير. والأفضل من ذلك كله، فإن معظم ميزاته الرائعة مجانية وسهلة الاستخدام. يمكنك استخدام بويرشو لإيجاد وتحميل المثال على الانترنت باور بوينت العروض التقديمية على مجرد عن أي موضوع يمكنك أن تتخيل حتى تتمكن من معرفة كيفية تحسين الشرائح والعروض الخاصة بك مجانا. أو استخدامه للعثور على وتحميل ذات جودة عالية كيفية بويربوانت العروض التقديمية بت مع الشرائح مصورة أو الرسوم المتحركة التي سوف يعلمك كيفية القيام بشيء جديد، أيضا مجانا. أو استخدامه لتحميل الشرائح بويربوانت الخاصة بك حتى تتمكن من مشاركتها مع المعلمين الخاص بك، والطبقة، والطلاب، ورؤساء، والموظفين، والعملاء، والمستثمرين المحتملين أو العالم. أو استخدامه لإنشاء عروض عرض الصور باردة حقا - مع التحولات 2D و 3D، والرسوم المتحركة، واختيارك من الموسيقى - التي يمكنك مشاركتها مع أصدقائك الفيسبوك أو دوائر جوجل. ثاتس جميع مجانا كذلك مقابل رسوم رمزية يمكنك الحصول على أفضل صناعة على الانترنت الخصوصية أو علنا ​​تعزيز العروض التقديمية وعروض الشرائح مع أعلى الترتيب. ولكن جانبا من ذلك حر. حسنا حتى تحويل العروض التقديمية وعروض الشرائح في شكل فلاش العالمي مع كل مجد الوسائط المتعددة الأصلي، بما في ذلك الرسوم المتحركة، 2D و 3D الآثار الانتقالية، الموسيقى جزءا لا يتجزأ من أو غيرها من الصوت، أو حتى الفيديو جزءا لا يتجزأ من الشرائح. جميع مجانا. معظم العروض وعروض الشرائح على بويرشو أحرار في عرض، وكثير حتى مجانا لتحميل. (يمكنك اختيار ما إذا كان يسمح للناس لتحميل العروض التقديمية الخاصة بك بويربوانت الأصلي وعروض شرائح الصور مقابل رسوم أو مجانا أو لا على الإطلاق.) تحقق من بويرشو اليوم - مجانا. هناك حقا شيء للجميع العروض مجانا. أو استخدامه للعثور على وتحميل ذات جودة عالية كيفية بويربوانت العروض التقديمية بت مع الشرائح مصورة أو الرسوم المتحركة التي سوف يعلمك كيفية القيام بشيء جديد، أيضا مجانا. أو استخدامه لتحميل الشرائح بويربوانت الخاصة بك حتى تتمكن من مشاركتها مع المعلمين الخاص بك، والطبقة، والطلاب، ورؤساء، والموظفين، والعملاء، والمستثمرين المحتملين أو العالم. أو استخدامه لإنشاء عروض عرض الصور باردة حقا - مع التحولات 2D و 3D، والرسوم المتحركة، واختيارك من الموسيقى - التي يمكنك مشاركتها مع أصدقائك الفيسبوك أو دوائر جوجل. ثاتس جميع مجانا كذلك مقابل رسوم رمزية يمكنك الحصول على أفضل صناعة على الانترنت الخصوصية أو علنا ​​تعزيز العروض التقديمية وعروض الشرائح مع أعلى الترتيب. ولكن جانبا من ذلك حر. حسنا حتى تحويل العروض التقديمية وعروض الشرائح في شكل فلاش العالمي مع كل مجد الوسائط المتعددة الأصلي، بما في ذلك الرسوم المتحركة، 2D و 3D الآثار الانتقالية، الموسيقى جزءا لا يتجزأ من أو غيرها من الصوت، أو حتى الفيديو جزءا لا يتجزأ من الشرائح. جميع مجانا. معظم العروض وعروض الشرائح على بويرشو أحرار في عرض، وكثير حتى مجانا لتحميل. (يمكنك اختيار ما إذا كان يسمح للناس لتحميل العروض التقديمية الخاصة بك بويربوانت الأصلي وعروض شرائح الصور مقابل رسوم أو مجانا أو لا على الإطلاق.) تحقق من بويرشو اليوم - مجانا. There is truly something for everyoneThe history of information systems (IS) only span five decades. Yet from its inception, IS has done more to expand business and industry into global markets than any other convention in history. Today the backbone of IS is know as the World Wide Web, Internet, or with a business a Local Area Network, along with lists of acronym buzz word EDI, EIS, ERP, SCM and host of others to describe new ways in which IS can be employed to grow business. Contrary to the speed of information today, just over forty years ago, the business climate in United States was experiencing post-war growth much like it had never seen. Much of the experience that grew the economy had been learned during World War Two in tooling up the nations industries into producing an effective war machine. The field that developed out of this push to win the war was Operations Research (OR). When the war end those involved with OR were released from government work, thus unleashing an experienced and highly skilled field, like no other in history, into business and industry, which launched the US into a era of prosperity and growth that lasted over twenty-years. World War Two also saw the birth of the first practical computers or Turing Machines, which were responsible for cracking the German codes and giving the allies advanced warning of enemy movements. By todays standards these first practical computers were not that practical, half a million dollars and far less powerful than a pocket calculator which today purchased for under ten dollars. However these first computers gave Operations Researchers the power they needed to begin simulate larger and more complicated systems which in business and industry help greatly to hone uses capital expenditures into profitable ventures. This background from the early days of simulation, OR, and new technologies birthed studies into the areas of what became known as Information Systems. When and how were they first used Formalized By the mid-sixties IS was already forging its way into business mainstream. While computers remained out of reach for most businesses, telecommunications made its mark with the TELEX machine. This step gave businesses the ability to communicate within its own organization anywhere in the world at any time and effectively pass instructions and information. The use of computer in business and industry usually started off in the accounting departments. It was assumed that this area would know the most about using numerical machines and the lack of understanding in how important databases could be other areas of the business. By this time a number of business school began developing Management Information System (MIS) programs to meet the growing need of IS managers. During the seventies more upper management recognized the importance of IS and the flexibility it was bring to business. The TELEX became the standard of information transfer and the mainframe computer became the standard for database creation. As the need for organized and easy access to data became apparent, information based businesses began moving the mainframes from under the accounting management to it own department. Approaches toward IS Design and Why As IS begins to receive its own autonomy and large budgets in corporations, many technical savvy managers of these new departments begin spending huge amount of money on systems and software at their own discretion and many time out spend all other departments without any returns to the business. These were troubling and risky times for CEOs deciding to direct the business into IS based systems. The systems and software were complex, continually changing, and the people that knew the systems tended have their own agendas. Out of this turmoil came the basis of how IS develops with in businesses. Mainframes Vs PCs This new rush in what is now referred to as e-mail, was brought about by the invention of the mini and micro computer, which could put and entire system on an executives desk for a very low price compared to mainframes and the ability to have an autonomous system with out pay huge amounts of money to process information. Once again turmoil enters the relationships of IS and businesses, where software and hardware vendors begin making demands on businesses to switch there style of business to fit the computer systems. There was little standardization of software and hardware with many start up companies that went under there after leaving business with out any technical or system support, resulting in spending above budgets to install entirely new systems. As the desire to support different departments of a corporation with IS and the new affordability of hardware and software each department began to put IS programs together independently of MIS department. This result in a new position in companies: Chief Information Officer (CIO), a position that in many companies at this time rivaled the CEO. The need for this position was to standardize all of the electronic data interfaces (EDI) between all departments so information could be more efficiently. Quality Initiatives in IS Development The mid-eighties were the time most manufacturing companies began to shift to IS to forecast sales, take orders, and manage distribution of products. Time Berners-Lee developed the World Wide Web in 1989. This protocol HTML used over the existing Internets that had been constructed opened up a new era of EDI the world had never seen. Where by the mid-1990s it became apparent that there is no way for a corporation to efficiently do business without a solid functioning IS setup inside its own walls as well as connected with its supply-chain vendors and distributors. EDI once known as Electronic Data Processing (EDP) have now brought profit margins so low that any business that does not prepare itself will be out of business in the next five years. IS is a technology driven system. With out it, business would not be what it is today. It has evolved over the past forty years to being the back bone of business, yet the simple application rules created in the 1960s and 1970s are still very relevant in any application where data or information is transferred in what ever business model it is applied to no matter the complexity. Home CHAPTER 3 INFORMATION SYSTEMS - AN INTRODUCTION (TM) Basically an Information System handles the flow and maintenance of information that supports a business or some other operation. It contains information about significant people, places and things within the organization or in the environment surrounding it. Information is derived from meaningful interpretation of data. Data consists of the raw facts representing events occurring in the organization before they are organized into an understandable and useful form for humans. An Information System can be defined technically as a set of interrelated components that collect (or retrieve), process, store and distribute information to support decision making and control in an organization. Another definition of an Information system (by Buckingham et al (1987b) is. A system which assembles, stores, processes, and delivers information relevant to an organization (or to a society), in such a way that the information is accessible and useful to those who wish to use it, including managers, staff, clients and citizens. An information system is a human activity (social) system, which may or may not involve the use of computer systems. Also, in addition to supporting decision-making, information systems help workers and managers to analyze complex problems, to develop new products and to integrate the various modules and departments. Moreover the transmission lossesn inter-departmental communication are reduced considerably leading to better coordination and improved transparency (information sharing) within the organization as a whole. Three activities provide the information that organizations need. These activities are Input, Processing and Output. Input consists of acqui sition of the raw data, which is transformed into more meaningful packets of Information by means of Processing . The processed information now flows to the users or activities also called as Output . The shortcomings are analyzed and the information is sent back to the appropriate members of the organization to help them evaluate and refine the input. This is termed as feedback . Examples of Information Inputs would be Transactions, events which would undergo processing in the form of sorting, listing, merging and updating resulting in outputs such as detailed reports, lists and summaries. Another example would be in the manufacturing environment with information inputs such as design specs material requirements and the SOPs (standard operating procedures). These would be processed by the information system by modeling and simulation techniques and would result in standard production models along with the overall cost of the production process which is calculated by the information system from the knowledge base containing material costs, hourly labor costs and other indirect costs. Hence almost totally eliminating a distinct costing function in the scheme of things. However an information system cannot just be broadly described as an Input-Process-output mechanism in vacuum. It is required to provide major organizational solutions to challenges and problems posed in the business environment. Hence a manager needs to be not just computer-literate but also have a good idea of the organizational structure and functions as a whole. This concept is illustrated in the figure on the opening page. Also, at the heart of the issue Information systems should not be confused with information technology . They exist independent of each other and irrespective of whether they are implemented well. Information systems use computers (or Information Technology) as tools for the storing and rapid processing of information leading to analysis, decision-making and better coordination and control. Hence information technology forms the basis of modern information systems. 3.1 Types of Information Systems Types of Information systems (Source: Management Information Systems, Laudon and laudon) The six major types of information systems corresponding to each organizational level (the four levels shown in figure above) are: 1. Transaction Processing Systems (TPS): serve the operational level of an organization. 2. Knowledge work systems (KWS) 3. Office automation systems (OAS) to serve the knowledge level of an organization. 4. Decision-support systems (DSS) 5. Management information systems (MIS) serve the management level of the organization. 6. Executive support systems (ESS) serve the strategic level of an organization. (Source: Management Information Systems, Laudon and laudon) CHAPTER 4 DEVELOPMENT OF INFORMATION SYSTEMS (TM) As mentioned earlier, every company to start with, has an information system already in place, be it a file card and pencil based system, a computerized system or an intermediate of the two. Hence the IS development process involves work on an existing system - mapping the system, automating it and making sure that it functions according to user requirements. Hence in its first phase the process attempts to determine the scope and type of new system that the user wants. The next phase analyzes the above requirement in two parts to facilitate detailed verification and validation before the system is actually designed and implemented. 4.1 Beginning with the users Infact the entire concept of Information systems development revolves around the users - their needs, performance expectations, requirements and other specifications. The very succcess or failure of an information system may be measured by the level of satisifaction of its basic users in the organisaiton. It is very essential that the database satisfy the requirements of the user, otherwise he or she will continue with his or her own system and thereby defeat the purpose of the central database. The key element in this concept is that each subsystem utilize the same database in the satisfaction of its information needs. This will yield an additional significant advantage - the integration of departments and functions. Thus each department, through its access and interface with the total information resources of the company, gains a greater understanding and appreciation of how its actions and plans affect others throughout the organization. An important question that can be raised is why is it important to analyzeand design information systems before you build them. Why cant you build the information systems directly The main reasons are: 1. It is important to build the information systems that the users really need. You dont know what they really need if you dont start with some kind of analysis and design. 2. It is a waste of resources to build information systems without sufficiently good blueprints because it takes more time and yields worse results if you dont have blueprints. Analysis and design is performed to meet information needs. If it is required to arrive at models that describe information systems that the users really need, then interest groups (or user groups) generally have to participate in the work. Another reason for performing analysis and design is that those who participate in such work learn much about the new information systems. To be able to use information systems requires knowledge about how these systems work. Participating in the analysis and design work is one way of obtaining such knowledge. 4.2 Determining need and performance expectations As every company has an existing system and the process of IS development involves system conversion. The general steps involved in the conversion are: 1. System Description (narrative or pictorial) 2. Input Documents ( item description, layouts etc.) 3. Output Documents ( report formats, output requirements etc.) 4. File Design (involves the system design process explained in the next section) 5. Program Logic (by the use flow charts or other methods) 6. Computer Program (COBOL, DYNAMO, BASIC, PASCAL, FORTRAN to name a few ) 7. System Verfication 8. Documetation Potential problem requirements surrounding database construction are generally those connected with interdepartmental coordination and agreement. These might include. - possibility of invalid input of information by a unit wishing to maintain information security. - the multiplier effect of erroneously entered data, which has an immediate influence on other departements utilizing the data. - the time dimension of input data, which requires that user departments agree on the time during which a transaction should be reflected data input. - the interdepartment agreement required concerning the degree of detail to be included in data elements of the database. As a consequence of the above problems that have been identified some of the desired features of the system would be. - Simplicity or ease of usage and handling (by employing graphic user interface - based entry and retrieval systems) - Adequate security featuresfirewalls for restricitng unauthorised access (both within the organisation and on the web) and - A very rigid backbone-operating system to support the numerous organizational functions at different levels. A clear-cut knowledge of the expectations or requirements of the system being developed would entail a listing of some performance metrics. The measurement of costs or benefits is a measurement of change between the old and the new. In other words we may measure the change in the total output of the system or measure the many changes accomplished throughout the system. The former is obviously the most desirable. It is probably rare that a measurement of the total system is attempted at the system level. Some broad concepts that need to be kept in mind during system development include. 1. System Integrity . How well are the sub systems integrated into the total system without redundancy. How flexible is the system. How easily may the system be expanded. 2. Operating Integrity . How skilled are the people operating the system What back-up is there to prevent system breakdown in the event of loss of key personnel or equipment failure. 3. Internal Integrity . How well does the system do what it is supposed to do. How valid are system outputs. How secure is the sytem against human error, manipulation, sabotage or theft. 4. Procedural Integrity . How good is the documentation of the system and procedures. Are procedures such that employees are motivated to follow them. How well are procedures followed in practice. What controls ensure that procedures are followed. - Change analysis has to be performed before information systems development is performed. Change analysis is the analysis of suitable changes of the activities of an enterprise in concrete situation. The purpose of change analysis is to formulate the problem before you start to solve it. Developing information systems is effective only if you have information system problems or needs. Problem oriented work must be performed before data oriented work is performed. Problem-oriented work in information systems development refers to the development parts whose purpose is to specify what the information systems will do (seen from the users view). Data-oriented work refers to the development parts whose purpose is to design technical solutions to this specification. It is only effective to perform data oriented work if you have a problem-oriented specification as a basis. The concept is explained in further detail in the first phase of process design,( i. e requirements analysis.) 4.3 Characteristics of good organisational IS talent A manager needs information for a variety of reasons concerned with the management process. The type of need that he or she will have at various times and for various purposes depends largely upon 2 factors that we shall examine briefly. the personal managerial attributes and the organizational environment in which decisions are made. 1. Knowledge of information systems If managers are aware of what computer-based systems can do, their information requests will probably be more sophisticated and more specific. Their knowledge of capabilities and costs places them in a much better position to aid in the design of a good system. 2. Managerial Style A managers technical background, leadership style, and decision-making ability all affect the kind and amount of information required. Some prefer a greater amount Others like to decide with a minimum of detail and prefer personal consulatation with subordiantes. 3. Managers perception of information needs You tell me what I need to know and get me all the facts represent two opposite perceptions of information needs. This dichotomy is due partly to the fact that many managers are ignorant of what information they need. Another dimension of the problem is the widely differing views of the managers regarding their obligation to disseminate information to subordinates and to groups outside the firm. Teh manager wh ocannot or will not delegate authority is likely to keep information closely held. 1. Nature of the company Problems in communication and in controlling operations seem to be a function of the comapnys size and the complexity of its organization. The larger more complex firms require more formal information systems, and the information needs of these systems become more critical to operations. 2. Level of Management There are three levels of management (i. e strategic planning, management control, operation control) and the varying needs for information at each. Each level needs different type of information, generally in different form. top levels need the one-time report, the summary, the single inquiry. The management control level needs the exception report the summary and the variety of periodic reports for regular evaluation. The operational control level requires teh formal report with fixed procedures, the day-to-day report of transactions, to maintain operational control of actions as they occur. Managers at all levels have changing information needs, depending on the nature and importance of the particular decision. 3. Structure of the organisation The more highly structured the organization, the easier it is to determine the information needs. Where authority and responsisbility are clearly speelled out, relationships understood, and decision-making areas defined, the information needs of managers can be determined more easily. (Above section adapted from Information systems for modern management by Murdick, Ross and Claggett) 4.4 Stages In Process Design: The Process of information systems development in its first phase attempts to determine the scope and type of system the user wants. The next phase analyzes the above requirement in two parts to facilitate detailed verification and validation before the system is actually designed and implemented. This stage consists of obtaining user needs and requirements which reflect the user-expectations from the IS being developed. It consists of several stages: 1) Problem definition 2) Feasibility Study 3) Requirements Acquisition 4) Requirements Analysis The problem definition and feasibility study stages consist of definition of a bare outline of the desired system. The Problem Definition Stage defines to a high level of detail the application for the desired IS and an indication of the advantages that will result from its implementation. The Feasibility Stage is the examination of the different alternatives with which a solution can be found for the design of the desired system. The Requirements Acquisition Stage results in a statement of requirements. The Requirements Analysis stage produces the requirements specification. Using the statement of requirements as the main input the aim of the requirements specification is to act as an overview of the desired system in a structured form. This phase analyzes the requirements from the previous phase and converts them into components, which are used to build a specification of the desired system. The specification is more precise than in the previous phase and adds more detail, at the same time retaining user semantics, so that the description would be recognizable to the user. However the model is at an abstract level, that is, with no details concerning data representation or computer implementation. This phase produces a design of the desired system that will serve as a basis for computer implementation. There are two major tasks in logic design. Firstly the specification from the analysis phase is transferred and secondly the human computer system is designed. The significant difference in this phase is that the structure component is now represented by data. There will often be several possible ways of representing relationships. We may also use normalization in this phase. We decide exactly what data types are required for data representation, how many characters are required for each data item and we design records and files or databases to store the data, taking into account the type of processes that will operate the data. An abstract programming form is often used here, such as structured English, JSP diagrams or action diagrams. In addition DFDs may be drawn showing the processes that occur, the data input to and output from each process etc. The second major task in logical design consists of design of human computer systems. Two levels of detail are normally considered here: - Design of user procedures which consist of tasks and processes with which users will be directly involved - Computer interface design consist of the detail of processes and the objects on which these processes operate, and may involve considerations related related to interaction style ( screen and report layouts, human-computer dialogues), specifications of manual or mechanical operations, and off-line or online processing. This is the last of the design phases. We may consider it as consisting of 3 components: Hardware, software and human-computer systems. The hardware design consists of a description of the computers, storage devices, inputoutput devices and possibly networking devices required for the desired system. Software consists of the programs that run on the hardware. The physical design of data needs to be considered as the kind of data invariably affects the programs that process the data. It will be necessary to decide on the appropriate types of applications software, including languages and packages as well as systems software required for supporting the eventual system. There are four options for process design 1. For standard processes, we can buy packaged software. For example, accounting software is largely standardized. 2. Use of a fourth-generation language such as lotus123, VB, Oracle etc. 3. Generate code using a CASE tool 4. Write our own code. If in-house coding is done data structures are chosen for the representation of data in the programs, together with decisions as to the programming language required for eg. COBOL, C etc. Issues such as execution speed and ease of maintainability of program code are considered. Human Computer system design Some of the design of this system specifies the activities to be followed when communicating with the computer, for example, detail of dialogue between computer and operator, procedures for starting-up and shutting down the system and screen contents such as windows or colors etc. Implementation And Testing The major output of the implementation and testing phase is a physical information system and not a design. Of course the physical and earlier designs remain available for reference, as they form the specification. The major tasks consist of: Acquiring and integrating hardware, producing software, generating data for the files or databases and producing the human-computer system. System is tested, user comments are evaluated, perhaps to redesign the system. The operation of the implemented system in the user-organization if monitored closely for a limited period. Maintenance The maintenance phase consists of correcting errors in the system or responding to changes in the user requirement, due, for example, to environmental changes or personal preferences for system operation and it may require reworking of all the previous phases for the part of the system that requires changing. 5.1 System Design The basic information model consists of three parts as shown below and the data dictionary. The external models represent the user views of the system. These are brought together into a single global conceptual model as illustrated below. The conceptual model does not take into consideration how the data and processes will be implemented on the computer. This is accomplished through the internal model (shown as schemas and programs in the diagram below) 5.2 Stages in IS modeling As mentioned earlier, we do not design the internal model right away. A conceptual information model is first formulated and this is then translated into an internal model. Also we need to develop two conceptual models (a) A conceptual data model and (b) A conceptual process model. These are then checked for consistency and, any necessary modifications are made to arrive at the data processing model. This is the first level information model. (the data model, the process model and the data processing model) otherwise called first level design . Second level design is concerned with adapting the first level design to the specific requirements of the processing required. It may be that the first level design consists of so many relations that it would not achieve an acceptable level of performance if it were implemented in that form. Hence the model may need flexing to accommodate the demands of the functions which the information system may support. The result of this is the second level design information model. The final stage is the third level design where the model is mapped into the internal schemas required by the software being used to implement the system. The process of moving form first to second to third level design may seem rather long but it is important for a number of reasons. The first level will provide a transaction-independent view of the information content of the system. However it will still be enterprise-dependent because the data model will only reflect the things of interest to that enterprise. The second level design is enterprise or transaction dependent, but is still independent of hardware and software. Hence the second level can be used to evaluate alternative implementations and assist in the selection of hardware and software. Third level design is enterprise, transaction and software dependent. The process of design is shown in the diagram below. IT is important to note that this process does not equate the design of the entire information system. In particular it does not cover data on establishing the feasibility of an IS, nor on strategic decisions involved in selecting an information area. Similarly nothing is said about the design of forms, codes, screens and reports nor of the techniques for the analysis of the requirements of the users. 6.1 System Development Methods (MR) ( Source. Yourdon system methods, model driven methods, 1993) The evolution of system development methods has been gradual. The three stages in the evolution of system development methods may be identified as. 1) First generation methods. 2) Second generation methods. 3) Third generation methods. First Generation Methods These methods includes various structured techniques developed during late 1960s and 1970s. Structured techniques breakdown a complex problems into smaller components with well defined inter-relationships between components. DIVIDE and RULE Components of First generation methods: 1) Structured programming. 2) Modular design and structure charts. 3) Programming style. Modular design . many programming languages allow groups of statements to be reused, such a group of statements are called program module and their use is referred as modular programming. structure charts show how modules are connected to form a program. Programming style . using standard constructs, code can be complex and difficult to understand and it was also understood that maintainable code also required style guidelines ( 1970s). Data Structures . data design tech. used in 1970s were pragmatic ways of building data structures and files to support programs. CODASYL organization was upfront in database design in late 60s. Structured Design . structured programming technique only addresses design in small. these never gave any guidelines on how to carry out design in the large. Successive refinement (Top Down Functional Design): A required system function was broken-down to smaller number of tasks that could be combine to accomplish the function. Each of these were in turn broken down into smaller sub-tasks. The process was continued until the subtask was so simple that it could be coded with little chance of error. Techniques based on the semantics of the structure chart Main criteria for improving program design were based upon. Coupling: measures the complexity of interfaces, If interfaces between module are simple, design is described as having low coupling. Cohesion: measure of how single-minded a module is. If module carries out exactly one well defined function it is described as having functional cohesion. Data Refinement . Relation data model, which treats all the data as tables. Refinement criteria were used to check the quality of design. Application of these criteria is called normalization. Structured Analysis . The set of tools and techniques referred to as structured analysis were developed to address the problem of identifying and stating the user requirement in an unambiguous, understandable form. These techniques were mainly Process-oriented concentrating on required system functions. Modeling tools . The main need was for modeling tools that would help to partition complex requirements into smaller units with well defined inter-relationships. The modeling tools used were. 1) Data Flow Diagrams to show the portioning of proposed system into smaller functional areas or mini-systems. 2) Mini-specs to specify each mini-system. The use of review sessions, where part of the requirements was also presented was a key technique capturing user requirements. These review sessions were termed as structure walkthroughs. Information Modeling: at the same time as structure analysis were developed, a semantic approach to information modeling was formulated. This was based on real-world entities and relationships. Problems with top down functional decomposition (TDFD) : Top down functional decomposition was carried out by trying to guess what main functional area were. Each functional area was then examined in turn and successively broken down until the functions were simple enough to verify with the user. This lead to second problem that caused TDFD to be supplemented or replaced in the second generation methods. Correct partitioning of the system could not be done until system was understood and system couldnt be understood until it had been partitioned. Because of this problem an optimal statement and organization of the user requirement was very time consuming, required considerable reworking of the models and due to time pressure it compromise on quality of work. TDFD is creative technique and reflects the way the analyst thinks or perceives the system. The logical model tends to reflect the unconscious bias of analyst towards a specific solution. Fragmentation of Policy Although there were guidelines that helped identify the best organization of the user requirements, it was sometimes found that functions which were widely separated in the model needed to be cross-checked. Different system development philosophies: 1) Process and data driven methods. 2) Phase oriented and model oriented development. Process oriented: concentrating on system functions and regarding the data as only being present to support system functions. Data Driven methods: Concentrating on information requirements, particularly in terms of identifying the data to be stored in database. Systems functions were considered to be less important. Phase oriented. System development life cycle was seen as sequence of phase, each consisting of well defined activities that had to be carried out. Model oriented. here life cycle was seen as a sequence of models of system requirements. Each model had a defined structure that could be checked. Second Generation Methods In First Generation (FG) methods developers were process oriented or data oriented and used modeling in fairly informal way. In all Second generation methods main stress is on the construction and checking of models. FG methods are largely independent approaches for dealing with each stages of system development life cycle. Second Generation methods provide a smoother development path from requirements analysis to later design and implementation stages. FG model is used to capture system requirements in policy terms, later models elaborate on how the model is mapped onto available technology because models are not independent but each model evolves into the next, taking into account another layer of technology. FG methods viewed system from one viewpoint with relative poor modeling from other viewpoints. SG methods regard system functions and data as two equally important aspects the system. Second generation methods were externally oriented. Analysis techniques are based on real world requirements of two types a) response to real world events and b) store information about real world entities. Real World Events. Time is more explicitly modeled in terms of events that occur in the environment of system. System behaves as they do only because of these events that occur and requires policy for responding to these events. Real World Entities. By collecting information about real world entities and the relationships between them, the analyst avoids bias towards any possible data storage organization. CASE (Computer Aided Software Engineering ) Use of CASE was not common until 1980s although such tools become available from about 1975.Some case products have draw what u want approach and some have more well defined grammar that the diagrams can be checked against. The second generation technique are mainly Diagram Oriented unit of modeling is a diagram. Diagrams are drawn and checked. Reasons For Third Generation Methods The second generation view of models is rather low-level. It deals with individual diagrams rather than the larger issues of how individual analysis and design unit fit together and interact. Third generation methods will be distinguished by a philosophy that is more concerned with the whole rather than parts. 6.2 Techniques (TM) An information systems development methodology can be defined as a collection of procedures, techniques, tools and documentation aids that will help the systems developers in their efforts to implement a new information system. A methodology will consist of phases, themselves consisting of sub-phases, which will guide the systems developers in their choice of techniques that might be appropriate at each stage of the project and also help them plan, manage, control and evaluate IS projects. Methodology . As defined above it basically represents a way to develop IS systematically. Techniques: May involve the use of one or more tools which represent some of the artifacts used in information systems development. أدوات . Tools are usually automated, that is, computer tools normally software to help the development of an IS. Techniques may be used in common among several methodologies. However they are not interchangeable because when used in a particular methodology they could address different parts of the development process, be used for different purposes or be applicable to different objects. Listed below are the techniques used in the information systems development process: 1. Rich pictures 2. Root Definitions 3. Conceptual models 4. Entity modeling 6. Data flow diagramming 7. Decision trees 8. Decision tables 9. Structured English 10. Action diagrams 11. Entity life cycle 12. Object orientation 13. Structure diagrams The above table shows the position or stage in the development where any particular technique is utilized and whether it is primarily regarded as general, or data or process-oriented. The asterisk indicates the IS development stage or stages (discussed previously) in which the technique is most commonly used. For example entity modeling is used in two stages but its use at the logical design stage is most common. Tools (especially automated tools) are available in plenty for the system development process. Listed below are a few tools classified (and thereby defined) into some significant groupings. 1. Project management tools 2. Database management systems 3. Data dictionary systems 4. Systems repositories 5. Drawing tools 6. CASE (computer aided software engineering) tools Methodologies for information systems development make use of some of the process-oriented techniques of functional decomposition such as data flow diagrams, decision trees, decision tables and structured English. Functional decomposition gives structure to the processes reflected in particular by the most important technique of data flow diagrams. This emphasis on structure gives the name of the first methodology STRADIS. Some of the several methodologies proposed for IS development include: STRADIS (Structured Analysis And Design of Information Systems) follows the Top-down approach (functional decomposition) for analyzing processes. YSM (Yourdon Systems Method) Although, at the outset, this was very similar to STRADIS it differs in the more recent versions wherein it follows a middle-up approach to analyzing processes also called as event partitioning, which is more appropriate than the top-down approach. As a result of some such features as the above and also due to better ease of understanding and clarity of depiction, we employ the YSM in our future study and analysis of IS in industry. IE (Information Engineering). Whereas the fundamental techniques of the above two process-oriented approaches are functional decomposition and data-flow diagrams, the basic approach in IE is the data-oriented entity relationship approach. SSADM (Structured systems analysis and design methodology). It can be said to be the modern version of the traditional Information systems development life cycle approach. It includes the techniques of data flow diagramming and entity life histories, and recommends the use of tools, such as CASE tools and workbenches. Merise Unlike as in the previous methodologies wherein emphasis has been placed on either process or data aspects, Merise has been designed such that both are considered equally important and these aspects are analyzed and designed in parallel. JSD (Jackson Systems Development) is the development of Jackson systems programming (JSP) (which has had a profound effect on the teaching and practice of commercial computer programming.) into systems development as a whole. This methodology concentrated on the design of efficient and well-tested software, which reflect the specifications and is particularly applicable where efficiency is of paramount importance, for example in process control applications. Object oriented Analysis. This approach reflects the view that in defining objects and their component parts (attributes) we capture the essential building blocks of information systems. Also it is a unifying approach as analysis and design can be undertaken following this approach. ISAC (Information Systems Work and Analysis) This methodology seeks to identify the fundamental causes of users problems and suggests ways in which the problems may be overcome (not necessarily through the use of computer information systems) by the analysis of activities and the initiation of change processes. It is therefore a people-oriented approach with emphasis on the analysis of change and the change process. (Source: Information Systems Development: Methodologies, Techniques and Tools by Avison, Fitzgerald) ETHICS ( Effective Technical and Human Implementation of Computer based Systems). Also a people-oriented approach and encompasses a socio-technical view that, in order to be effective, the technology must fit closely with the social and organizational factors in the application domain. SSM (Soft Systems Methodology). Whereas most of the earlier approaches stress on scientific analysis, breaking up a complex system into its constituent parts to enable analysis, systems thinking might suggest that properties of the whole are not entirely explicable in terms of the properties of its constituent elements. SSM addresses the fuzzy, ill-structured or soft problem situations which are the true domain of information systems development methodologies, not simple technical problems. (Source: Information Systems Development: Methodologies, Techniques and Tools by Avison, Fitzgerald) Multiview is a hybrid methodology that brings in aspects of other methodologies and adopts techniques and tools as appropriate. Basically a contingency approach. techniques and tools being used as the problem situation demands. Process innovation does most to tie business process reengineering with information technology and information systems, IT being seen as the primary enabler of process innovation as it gives an opportunity to change processes completely. (Source: Information Systems Development: Methodologies, Techniques and Tools by Avison, Fitzgerald) RAD (Rapid application development) is in response to the need of rapidly changing business environments. It is usually enabled by CASE tools and systems repositories. KADS is the outcome of a European research project to develop a comprehensive, commercially viable methodology for knowledge-based systems construction.. Euromethod also results from a european initiative and is more of a framework for the procurement and management of services for the investigation, development or amendment of information systems than methodology. (Source: Information Systems Development: Methodologies, Techniques and Tools by Avison, Fitzgerald)CHAPTER 7 SYSTEM DESIGN AND MODELLING (MR) 7.1 Business Process Redesign (Ref: Engineering management review (Vol 26,number 3, fall) Business Process Redesign is defined as the critical analysis and radical redesign of existing business processes to achieve breakthrough improvements in performance measures. In 90s 2 tools revolutionised the organisations these were. 1) Information Technology 2) BPR ( Business Process Redesign ) IT . This includes the capabilities offered by computers, software and telecom. IT is considered as analysis and modeling tool. Thinking about IT should be in terms of How it supports new or redesigned business processes. Use of IT in Manufacturing Industries. a) Process Modeling. b) Production Scheduling and Controls. c) Materials and Management Information Systems. Business Process ( BP ) . Business processes are defined as set of logically related tasks performed to achieve a defined business outcome. Set of business processess forms a business system. Business processes have two important characteristics. a) They have Customers. Recipients of outcome. b) They cross Organizational Boundaries. Five steps in (PD) Process design. 1) Develop Business Vision and Process Objectives. Prioritize objectives and setstretch targets. 2) Identify the Process to be Redesign. To find out critical processes. 3) Understand and measure existing process. Identify current problems. 4) Identify IT levers. To think of new process approach. 5) Design and build a prototype of the process. Implementation. Develop Business Vision and Process Objectives. In past process redesign was to rationalize the process, i. e to eliminate obvious bottlenecks and inefficiencies. Most likely Objectives. Cost Reduction . Important objective with others but insufficient in itself, while optimizing other objectives seems to bring the cost inline but not the vice-versa. Time Reduction . Common approach for reducing time is to make steps simultaneously rather than sequentially, using IT to co-ordinate. Output Quality . Specific measures may be uniformity, variability or freedom from defects. This is mostly defined by customer of the process. Setting goals that will stretch the organization will also provide inspiration and stimulate creative thinking. Identify the processes to be redesigned. Most of organisation could get benifit from IT - enabled redesign of critical (if not all) business process. Two major approaches. Exhaustive approach High Impact approach Exhaustive approach :Attempts to identify all the processes within an organization and prioritize them in order of redesign urgency. High Impact approach . Attempts to identify only most important processes Redesign process should be containing . a) Begining and end points. b) Interfaces. c) Organisation units involved. Understand and Measure existing process . This is required because. a) Problems must be understood so that they are not repeated. b) It can act as a baseline for future improvements. Identify IT Levers . Role of IT in process design should be considered in early stages of redesign. All of IT capabilities involve improving coordination and information access across organizational units, thereby allowing more effective management of task interdependence. Design and Build a prototype of the process . After all the studies and data collection, brainstorming workshops bring a design which also goes through successive iterations. Building a prototype of IT change usually achieves results faster than conventional life cycle. The process design after agreements by owners and stakeholders are implemented on pilot basis ( Parallel with the existing processess) examined regularly for problems and as the process reaches final acceptance, it is phased into full implementation. Defining Process Types : Three major dimensions can be used to define processess, 1) Organisational entities or subunits involved in the process. 2) Type of objects manipulated. 3) Type of activities taking place. Defining Process entities . Inter-organizational Processes. These are the processes where two or more business organization co-ordinates with each other. Inter-functional Processes. Achieve major operational objective such as new product realization, asset management, production scheduling. Interpersonal Processes: These are the processes within and across small groups. Using electronic mail and conferencing. Defining Process Objects . There are 2 primary object types. a) Physical b) Informationl In Physical object processes real, tangible things are either created or manipulated. informational object processes create or manipulate information. Adding information to a physical object as it moves through a process is a common way of adding value. Using IT to improve physical processess allows greater flexibility and variety of outcomes, more precise control of process, reduction in throughtput time, and elimination of human labor. Defining Process Activities . There are 2 Activity types. a) Operational b) Managerial Operational activities involves basic business activities in the orgainisation. Mangerial activities includes control, plan or providing resources for operational processess. Capabilities of Information Technology for reshaping management issues includes . a) improve analytical accuracy b) enable broader management participation c) can generate feedbacks d) can streamline the time and resources a specific process consumes. To attain SCM integration, it is necessary to understand the infromation requirements of all the participants and design system that facilitate co-operation . Why BPR Project fails 1) Lack of sustained management commitment and leadership. 2) Unrealistic scopes and expectations. 3) Resistance to change. 4) Narrow technical approach. 5) Cost-Cutting focus. What can be done to make a BPR a Success 1) Do something smaller first ( Pilot Experiments ). 2) Conduct personal transformation ( change of mindset ). 3) Get IS and HR involved. 4) Empowered and collaborative workers support. 5) Realistic expectations. 6) Prioritise the objectives. SUCESS OF BPR DEPENDS ON THE PEOPLE WHO DO IT AND HOW WELL MOTIVATED ARE THEY. 7.2 System Modeling (Source. Yourdon system methods, model driven methods, 1993 ) Uses of Modelling Tools. 1) Focus on important system features. 2) Medium of communication with users. 3)Document the systems analysts understanding for the impementation for implementation by designers and programmers. There are 4 main types of modeling tools used inYSM ( Yourdon System Methods ) 1) Graphic 2) Tabular 3) Frame 4) Textual Graphic Tools . These are used to show high level components of particular aspect of a model. Each graphic modeling tools has set of icons used to represent specific model component. Graphic tools are preferred type of modeling tools when the connection between model components is important. Graphic tools in essential modeling are mainly of a semantic nature highlighting the meaning of the requirements. Graphic tools in implementation modeling are mainly concerned with syntax or structure. Tabular Tools . Some information is usefully laid out in tabular forms. Tabular tools may be useful in some circumstances particularly if subject matter expert finds the graphic modeling tool difficult to relate to. Frames . Frame is used informally for a certain type of specification tool. Frame specifications are used to specify all relevant info about a model component that has been declared on a diagram or another frame. Textual Tools . Textual grammar is defined formally, using meta language or set theory. 7.2a Entity Relationship Diagram (ERD) . ERD is semantic modeling tool used to identify and organize information and to model particular roles of importance to the enterprise and relationships between them. This may also be used as a tool for discovery of rules and events. These are not contingent on the modelers point of view or interpretation as these are real world facts. Enterprise Essential Model uses ERD to define entities it uses and the relationships between them. System essential modes uses ERD to show the entities and relationships that the system has responsibility for collecting or using information about. Components of ERD. Entity . Entity is a class of real world thing whose role of interaction with the enterprise is well-defined. Each entity has a unique name which should reflect the role that is played by that type of object. These things may be physical objects abstract concepts. Each entity must be distinct from but fulfill the same role as other occurrence of the entity. Instructor in ERD defines entity. Relationship . relationship represent possible associations that may occur between occurrence of entities. On diagram, each relationship is shown linked by lines to entities to which it refers. Occurrence of the relationship represents a single instance of the association between entities. Relationship Frame . Each relationship frame that includes the entities involved and other text forming a complete sentence. مصدر. Yourdon system methods, model driven methods, 1993. Each occurrence of relationship corresponds to a specific occurrence of a Course and a specific occurrence of Topic. Binary Relationship . A relationship that refers to two entity occurrences is called binary relationship. Higher order Relationship . A relationship involving more than 2 entity occurrences is referred to as higher order relationship. مصدر. Yourdon system methods, model driven methods, 1993. When entity is repeated in relationship, the relationship is referred to as being recursive. For recursive relationships, the role for the entities must distinguished as it can be seen in the frame that employee reports to other employee who is manager. مصدر. Yourdon system methods, model driven methods, 1993. If the occurrence of entities in a recursive frame is not significant the relationship is known as symmetric. The relationship is friend of is an example of symmetric relationship. For symmetric relationships. the role for the entities doesnt have to be distinguished. مصدر. Yourdon system methods, model driven methods, 1993. Associative Entity . This is the entity which acts as entity and relationship both. As a relationship it indicates a group of real world associations between entities. Attributes of associative entity do not describe the entities that participate in relationship but the occurrence of relationship between them. مصدر. Yourdon system methods, model driven methods, 1993. a - describes a relationship. b - date on which marriage took place is neither an attribute of man nor woman but it describe the occurrence of relationship. marriage - associative entity date-as an attribute. Each occurrence of marriage records the fact that specific man was married to a specific woman on a specific date. Subtype, Subtyping and Supertyping . Subtype. Subtype of entity is a well defined group of occurrences of entity that may be regarded as entity in its own right. Subtyping indicates that the enterprise regards the entity as being made up of number of distinct identifiable groups each of which is referred to as a subtype. Supertype. supertype is regarded as a general grouping of several entities. مصدر. Yourdon system methods, model driven methods, 1993. 7.2b State Transition Diagram ( STD ) STD models time dependent behavior. In STD, each state represents a period of time during which the system exhibits some observable behavior. مصدر. Yourdon system methods, model driven methods, 1993. Components of STDs Access : Access on STD shows the possible access to the occurrence of entity when change of state occurs. Create Access : causes a new occurrence of entity to exist. occurs for initial transition. Read Access : for an event which occurs and requires some attributes to be used but not necessarily changed. Update Access : used where some of attributes of entity are to be changed. Delete Access : after this entity do not exists. Match Access : to check whether a specific occurrence of the entity exists. Connector : Where it is difficult to draw diagrams without crossing transaction lines a pair of connector symbols may be used. On diagram connector opis used in this way. Entity : each STD is for one state variable of specific entity. Example shown is for associative entity scheduled course. An entity may have several STD one for each of its state variable. Entity death. this indicates that occurrence of entity no longer exists and cannot be accessed. Event . event is the thing which causes transition to take place. When this event occurs a change of state may occur for one occurrence of the entity but it doesnt always occur. The responsibility whether or not it does occur resides in a data process. Initial State . state of the occurrence of entity when it is created. A transition to this initial state is referred to as an initial transition and must always include create. State . Each occurrence of the entity have a well defined state for a given state variable. Each schedule course may have a status of open, running, full or finished. 7.2c CONTEXT DIAGRAMS This is a diagram where systems is represented as a system diagram in whole. Purpose of context diagram is to depict how the system is connected to, interacts with other entities which makes its ( data ) environment. مصدر. Yourdon system methods, model driven methods, 1993. Context diagram show all external entities which interact with the system and all data flows between these and the system. Components of Context Diagrams: Access Flow . access flow indicates that the system uses stored data which is shared between it and its environment. Continuous access flow. if system or a terminator continually updates or monitors the value in a store it is shown as continuous access flow. Discrete access flow. Access toa store that takes place at a particular instant of time. Data is present in store and can be accessed anytime. Context Process . This is a process group which represent the system. On context diagram system is regarded as a Black Box. All requirements for behavior or data storage by the system is considered to be within this process. Dataflow . data flow on context diagram either represents information produced within or outside the system which is used by outside world or by the system itself. Continuous data flow. continuous data flow represents a value that is available over a period of time. Discrete data flow. data flow that is only present for a instant of a time. Dialogue data flow. a data flow generated by the terminator for the use of system is combined with a data flow created by the system for use of terminator. Event Flow . indicates synchronization between the system and its environment. Continuous event flow. represents a status that is indicated over a period of time. Discrete event flow. event flow that is only present for an instant of time. Dialogue event flow. pair of event flows that occur at the same time may be combined and shown as a dialogue event flow. provided that they are tofrom the same terminator. Dialogue event flow is used to show a group of input flows, together with corresponding response flows either initiated by terminator or the system. Terminator . terminator is a producer or user of data that interfaces with the system. Data Store . a data store on the context diagram shows an interfaces between system and its environment. The store indicates that the system and terminator are decoupled in the sense that one can change values in the store independently of the other. 7.2d DATA FLOW DIAGRAMS (DFD) : A data flow diagram is the most important technique for modeling high level detail of the process within a system. These highlights the functions of the system and how they use stored information and transfer information between each other. مصدر. Yourdon system methods, model driven methods, 1993. They show how input data is transformed to outputs results through sequence of functional transformations. Components of DFDs. Access Flow . access flow is used to show that a process needs to use or change stored information to accomplish its purpose. An access flow from a store show that the process uses information held in the store. This may correspond to:- Match Access. The process checks whether an entity or relationship occurrence matching a particular criterion exists. Read Access. The process uses the values of one ( or more) attributes for a selected occurrence of the entity. Check Access. The value of a state variable needs to be checked. An access flow going to a store shows that the process will alter information held in the store, This may correspond to a :-a) Create access. to create a new occurrence of an entity or relationship. b) Delete access. to delete one ( or more) occurrence of an entity or relationship. c) Update access. to modify the value of an attribute. d) Change access. to change the state of a state variable. Continuous Access Flow . In some situations it is necessary to continuously monitor the value in the store. This is carried out using data process. Link between this data process and the store is shown as continuous access flow. Control Process . Control process coordinate the activation of processes and signal to other components of system essential model. The coordination is carried out by interpreting and generating event flows and controlling processes by triggering or enabling or disabling them. In figure control process control car oxidation shows that control logic must be present to coordinate the monitoring, changing and replacing of solutions. It also derives the movement of the car body by interpreting the state of the oxidation bath and generating required signals such as move car signal to move the car body. Continuous event flow . continuous event flow is one that is available over a period of time, such as the status of a device. Continuous event flows represent a situation or status that is either true or not. Data Flow . a data flow represents the information generated by a source and used by another system function or terminator. On a data flow diagram the source of the data flow may be. a data process. the function represented by the data process is the one that generates the information. a process group. the function that generates the information within this group. Continuous Data Flow. Data Flow that persists over a period of time is called as continuous data flow. The value is present over a period of time and may change during that time. The figure shows a continuous data flow solution strength used by the process monitor solution strength. Solution strength is the present strength of solution which is continuously present. Dialogue data flow. dialogue data flow contains several data flows as an interface. At lowest level there can be two data flows in direct relation to each other, one causes the other to occur. Comment . free-format comments may be added to the DFD to elucidate or stress any important points. Comments may be used to highlight any aliases, ties to previous or anticipated implementation. Data flow diagram name ( DFD Name ) A data flow diagram has the same name as the corresponding process group show on the parent DFD. The context diagram is treated as a DFD with one process group. Data flow diagram number ( DFD Number ) A data flow diagram has the same number as the process group it describes in more detail. The child diagram of the context diagram is numbered 0. Data Process . A data process is a process that solely transforms data. Data processes may be continuous or descrete. A continuous data process may generate continuous or discrete event flows. A discrete data process cannot generate continuous event flows. Data Store . Stores act as buffers between processes that are active at different times. A data store holds the data at rest. A data store between two processes decouples them a data flow between them synchronizes them. In the figure the data store solutions is a collection of entity occurrence of all possible solutions used in the bathing of car bodies. Dialogue event flow . Dialogue event flow is a packing of several event flows between two processes or between a process and a terminator. Discrete access flow . A discrete access flow is an access to a store that takes place under the control of the system at a particular instant of time. In figure the process Check solution is correct accesses the store solution in tank to insure that the solution is correct for the car that is about to be bathed. Discrete data flow . data flow that is variable for an instant of time is discrete data flow. A discrete data flow is transient and must be processed at the moment it occurs. In the figure solution change, generated by change to new solution represents the need to tell the operators that they must change to a certain solution. This is an example of discrete data flow. Discrete event flow . event flow available for an instant of time is called as discrete event flow. If a control process detecting the discrete flow is not active at the time it occurs, the event flow will be lost. Enable Disable . This represents a process being enabled and disabled from a control process. An ED represents the fact that the control process enables the process at one time and disables it subsequently. A process that is enabled will run whenever its stimulus occurs or run continuously until disabled. Event Flow . An event flow represents the occurrence of an event ( discrete ). or the state of something ( Continuous ). Event store . An event store is a mechanism for storing events relating to resources until they can be used by a control process. When an event detector signals an event store ( rather than use a discrete event flow), it can respond, or until the store is reinitialized. Process . A process is a system function. It is either a data process. a control process. or a process group. It may be either continuous or discrete. Process group . A process group represents a group of processes as a single icon on the diagram. This group may also contains internal stores and flows to accomplish its purpose - these are hidden within the process group. Process group are used to reduce the complexity of any one data flow diagram by combining related functions and naming the combinations for the general function that this group carries out. In the figure change to new solution is a process group comprising processes control solution change, determine new solution, detect empty tank, etc. A process group is drawn on the diagram as a solid circle, it cannot be visually distinguished from a data process without looking at its specification. Trigger . A prompt labeled T represents a trigger. The trigger will activate a discrete process. which will then run to completion and stop. In figure check solution is correct is triggered. as it will run in zero time and immediately reply with one of the two event flows correct solution or incorrect solution. Strengths and Weaknesses of DFDs Strengths . DFD method is an object oriented method that allows to design systems using objects. It is widely used and promotes easy architecture and coding of a project. This method is also easy to learn. The symbols are few and simple and easy to translate. Weaknesses . There arent many weaknesses associated with this method. The DFD for large programs can be hard to translate and take a lot of time. Also, once the DFD is drawn for such a program, it becomes difficult to read and understand what is going on. The data flow can become confusing to the programmer in such an instance. Also, if the DFD is not drawn with the great amount of detail, then it is not useful to the programmer. Another disadvantage of using the DFD model is that the symbols used are not common to all DFDs. Different models use different symbols for the structure of a DFD. 7.2e DATA DICTIONARY (ref :1. E. Yourdon (1989). Modern Structured Analysis, Prentice-Hall. 2. T. De Marco (1991). Introduction to System Analysis and Design. IInd edition, Prentice-Hall ) During the analysis and design of a system, huge amount of data is collected. If data is going to be referenced throughout the design, and several people are responsible for that design notation, then individuals who may not have initialized that data but will need to reference it need to know where it came from. Manually thumbing through several volumes of the data is not the most efficient way to find such information. To make sure that everyone can access it, it needs to be stored centrally in one document. A Data Dictionary fulfills that role. Dictionary is basically a way of organizing the information, which is collected. This information enables us to work out the composition of the data, uniqueness and consistency of names and definitions of terms, and document them in dictionary which all team members can use. Ultimately it contain all information that enters, leaves and is transformed by the system, the policies surrounding that information, and description of all other objects and events of interest. This includes: data composition policies about data object and attribute descriptions event and state descriptions entity descriptions and relationship descriptions process descriptions System aspects discovered during analysis may be lost unless they are not documented in dictionary, but if everything is documented in dictionary there are all chances that dictionary is huge and contains lots of data about data.2 good ways for proper management are. Strict discipline: there should be a shared understanding between project members about what needs to be documented and how, who maintains and updates what-and severe penalties for anyone not sticking to it. Computerize it: with a project of any size, the data volume contained in the dictionary becomes too big to be handled by manual methods so it must be computerized to make the access quicker. Concepts of notationNotation helps to denote the basic kind of relationships betweenamong data items and elements, plus other information. These are some examples of data dictionary notation. 1) entity 1 entity A element B element C ( element D ) here it is shown that an entity A is made up of element B and element C and may or maynot contain element D. 2) entity 1 travel claim approval form 2 it shows that travel claim contains 2 elements, approval form and set of expense receipts. entity 2 expense receipts travel receipt expense receipts consists of travel receipt and additionaly it could also consist of number of incidental expendature. entity 3 travel receipt coach receipt air receipt rail receipt receipts not needed for a car travel travel receipt is needed for any form of travel undertaken with one exception that receipt is not needed if journey is done by car. entity 4 approval form name ref. لا. claim total approval form has three parts, name of the person making the claim, the reference under which claim is made up and total being claimed. entity 5 ref. لا. B123 reference number has a discrete value, the claim needs to be referenced as B123. entity 6 name 2 a name must be 2 character long entity 7 claim 1 .2 2 Claim figure must be made up of 1 or more numbers, a decimal point, and another 2 numbers to indicate fractions. Problems with building and maintaining Data Dictionary If the data dictionaries are poorly maintained, even on a fair sized project problems can arise. Aliases, imposters, hybrids, and real-time or orphaned data cause some of problems. Aliases: same definition given to several items with different names. Giving a common name so that we have a single word defining them all can solve this problem. Imposters: items having the same name but multipledifferent definitions. Giving a different (logical)name or new name can solve this problem. Hybrid data: when definition has a hidden or mixed use. Using meaningful names and do the things right away without thinking of changing in future can avoid this very crucial problem. Orphaned data: when nobody owns data, and nobody knows who created them. Author, data of entry and other pedigree information should be recorded. هناك. therefore, a number of ways in which the data dictionary will be impacted when designing the system. Definitions need to be put through a filtering process in order to make sure that rogue definitions do not go undetected. Regular analysis of data definitions is a time consuming but important and necessary exercise. Home An increase in company size results in an increase in information collection, processing and distribution. Hence it becomes necessary to handle many customer accounts and production records with many more interrelationships. In addition to increased information records, information needs and associated difficulties there arises the problem of delegation of authority and responsibilities. Basic Information System The basic functions of the company such as production, sales, finance and management functions will not change. However the introduction of an MIS will facilitate fantastic improvement in the information communications network. The objective of developing or improving a management information system can be stated as below: To provide the type of information environment that will integrate the basic operating functions and To provide management with access to information relative to complex activities in decentralized organizations. Also, as the company grows and becomes more complex much of the basic functions and information needs remain the same. Some of these internal information needs are shown as below:1. Accounting Control 2. Plans and budgets 3. Payroll by hourly and salaried groups 4. Inventory of materials, in-process and finished goods 5. Sales by product, salesman. customer and Area 6. Purchasing records, vendors, commitments 7. Distribution-Transportation and warehousing 8. Production by product, customer, cost, overruns and backlog 9. Engineering-new products, schedules, equipment, costs 10. RampD etc. etc. Although the current trend is to develop IS (with computer applications) in the areas other than the traditional areas, the bulk of information systems lie in the following categories. Over time, a typical manufacturing company has developed the major information systems shown above. These systems are not separate and distinct they connect interact and otherwise tie the subsystems of the organization together through the medium of information. 9.1 Financial Information System The financial system is probably the most important single management information system, in the company, and in most companies it is the oldest and the best developed. These systems basically deal with large amounts of data and involve planning in the financial sector. However the budgeting function performed is wholly futuristic. Periodically the management approves a financial plan (the master budget) that assigns responsibility for maintaining incomes, investments and costs within standard limits. These plans are the basis for periodic financial reports and these reports are used by the system for exercising control and for futuristic planning. The major operating systems of a company along with their respective functions (Shown in figure above) merge or integrate with the Accounting and Financial Information System to facilitate financial reporting and for management information for planning and control. Moreover, the financial system has a very significant impact on other systems when one considers that the ultimate common denominator of many operating decisions is the dollar. Perhaps, Billing (Invoice Preparation) is the most widely used data processing application among financial information systems. 9.2 ProductionOperation System Model From an operating standpoint, such a system is undoubtedly the most important in a manufacturing company. It crosses all subsystem boundaries and has an effect throughout the company. The production Operations system is concerned with information about the physical flow of goods or the production of goods and services. It covers such activities as production planning and control, inventory control and management, purchasing, distribution and transportation. Because the quantities of data are so large and the timing of information so essential, the productionoperations system is the most adaptable to automation and yields the largest benefits in terms of immediate solution of critical and costly problems. Although other applications (eg. decision-making, total system simulation) may offer greater potential, this functional area usually offers immediate pay-offs. Sales Analysis Engineering Inventory Control and Production Scheduling ProductionOperations Facilities Purchasing Financial Sales and Distribution Integration of subsystems through the information flow in the productionOperations System (Adapted from. Information systems for modern management by Murdick, Ross, Claggett)9.3 Marketing Management Information System The basic areas of the marketing function that lend themselves to improvement through information systems include: (1) ForecastingSales planning (2) Market research (3) Advertising (4) Operating and control information. Examples include sales reports and distribution cost reports. A marketing systems should also take into account of the necessity elsewhere in the organization concerning for information concerning market sales, and other internal information that affects decisions in other subsystems of the company. Three types of marketing systems may be summarized as 1. Control systems 2. Planning systems and 3. Market research systems. Customer invoices Sales Profitability Marketing budgets by product by product Sales call reports product line product line Cost reports customer class customer Inventory reports cost center salesman Accounts receivable region Accounts payable salesman Annual Reports (customers, suppliers etc.) Analyses done by the system for periodic automated reporting. -- Life cycle analysis -- Marketing Personnel Analysis Also OUTPUTS of the system include (Adapted from. Information systems for modern management by Murdick, Ross, Claggett) CHAPTER 10 STRATEGIES FOR IS (JMJ) The face of business is changing. Businesses that do not become an e-business will not be around in five years. After watching the Superbowl this year, one might be will to accept these statements at face value. These statements lend themselves into being the mottoes of Silicon Valley, knowing these quotes come from Andy Grove chairman on Intel and also from a recent article in the Harvard Business Review by Hamel. It should obvious that an industry representative would make claims on the future that are much more hype than reality, but when these same statements are made in prestigious business journals, how does the business world react Information Systems are the medium of this evolution in business and the proliferation of technologies is the catalyst IS change. The major shift coming is the impact of the internet-platform for doing business, which is currently being done on proprietary EDI systems. It is believed by businesses on the cutting edge of technology that the internet will be a leveling field for businesses that could not afford EDI in the past. EDI also was once claimed to be an evolutionary business step, but at an average cost of 50 million dollars for the system and in many cases no return on the investment. the future of EDI looks very grim, so say some of the successful practitioners of EDI. In a recent joint study by the Economic Research Council and Oasig concluded that between eighty and ninety percent of EDI systems do not meet original performance goals. So while EDI is in its decline, is it prudent to embrace the new technologies of e-business Forecasts call for a growth of e-business from 43 billion in 1998 to 1.3 trillion in 2002. The world has been wrapped many times over with internet connection lines and business already make up ninety percent of internet traffic. There is little doubt that the internet is here to stay and it will have an impact on business, especially in the areas of information systems. If IS were about technology alone, its future would the very bright. Yet, information systems are more about the data and the people that use them to resolve problems. The technology is only a tool and not the answer to IS. Many software companies that do IS consulting and IS teams within the company may not agree with that philosophy, but software vendors have a tendency to be inflexible with their platforms and IS departments have a history of being rouge divisions within company structure. A strategy to look at the future of IS, really needs to examine the past, and take a sober look at how IS in its many forms have fallen short of its promises. Steve Cardell and Neil Tiffin in an article in Industrial Management compiled six rules for putting together information systems. 1. Do not re-engineer and implement systems concurrently. From there studies the success rate is less than five percent. 2. Recognize that people fix things and information technology does not. They site Henry Ford as an example, his plants were able to process steel from iron ore to finished product in three days, in which he kept a few days inventory. 3. The business, not the IS department owns the system. This keeps costs under control and implementation on track. 4. Have an effective decision making forum. Managers and department heads are already busy, incorporating a new system that changes policy can be made very difficult if they are not kept up on what changes are taking place. 5. Configure only what the business needs. 6. When given a choice, choose flexibility In reality strategies for IS come from studying data-flow with in an organization, and clearly defining the goals for the system and the users. If consultants are hired in they need to configure the system to fit the data flow of the business. Many EDIERP software companies had businesses reshape their data-flow, resulting in suboptimal returns. The new frontier of the internet and the information technology that drives it along with the heavy performances of high-tech industry market can be intoxicating to businesses, especially those IS illiterate. From the UH panel discussions, it becomes obvious EDI has work in only a few cases, there is no standard of IS software for the internet, everyone knows they must move to the internet, some of the companies invited to the panels do not have clear goals of how their organization should work with IS, and not one company was a the same level information technology if this is the picture of the real world, the opening statements quoted are very risky, either very naiumlve or very arrogant. Quietly below the surface-hype of technology lies the ultimate future of IS, in the areas of data flow analysis. This is the one common thread for all the business that have succeed with any IS system no matter the decade it occurred in. CHAPTER 11 E-Commerce and EDI 11.1 ELECTRONIC COMMERCE (TM) Electronic commerce may be defined as the entire set of processes that support commercial activities on a network and involve information analysis. These activities spawn product information and display events, services, providers, consumers advertisers, support for transactions, brokering systems for a variety of services and actions (e. g. Finding certain products, finding cheaply priced products etc.), security of transactions, user authentication. etc. Ref. N. R Adam and Y. Yesha. Electronic commerce: an Overview There have been several similar electronic technologies in the past, for example Electronic data interchange (EDI) and Electronic funds tranfer (EFT) have been around for more than 20 years now. While many of these have electronic trading technologies have had radical effects within their own markets and created their fair share of publicity, none have attracted the level of hype or have been hailed as purveyors of economic transformation to the extent that e-commerce has in recent years. المرجع. The Economist The Economist Electronic commerce survey :In search of the perfect market For example, EDI never gained the ubiquitous acceptance that was initially anticipated for it. High costs for initial investment, maintenance costs, or simply lack of preference by potential users kept EDI technologies from developing at a more rapid pace and has traditionally restricted its use to very large corporations. Electronic commerce has experienced an explosion due to the convergence of these technology developments, the merging of the telecommunications and computing industries, and the business climate. المرجع. C Beam and A Segev The rise of Electronic commerce :Contributions from three factors A ubiquitous digital infrastructure that provides an efficient means for communication and information sharing presents an extremely attractive new medium for electronic commerce and for the first time has the potential to deliver what the notion of EC has always implied. D. Tapscott. The Digital Economy: Promise and peril in the age of networked intelligence Electronic commerce involves issues (both technical and non technical) that are multi - disciplinary in nature. They are complex in nature and overlap significantly with each other. Technical research issues overlap with other technical research areas. For example, finding and filtering information is a fundamental requirement of an electronic commerce system but can be an equally important service for a digital library. The figure below depicts the multidisciplinary nature of EC. As shown in the fig. The model is made up of several major components, beginning with the consumer who is interested in purchasing some goods electronically from some vendors whose product lines are represented in and are part of a global electronic marketplace. The objectives of E-Commerce are several. Primarily they involve increasing the speed and efficiency of business transactions and processes, and improving customer service. Also EC should. - Streamline procurement processes thereby cutting overall costs via a more competitive process - Contribute to a decrease in the length of production cycles. - Enable enterprises to conduct business with distant partners the same way they do with neighboring partners. - Empower small businesses. - Create new services and businesses. - Help expand the horizon of participants. In contrast to the emerging area of EC, EDI (Electronic data interchange) which has been around (in the same form) for 20 years now is the cause of positive and negative effects on industrial structures. A true cost benefit analysis of the effects can be difficult to assess, however the costs become much easier to quantify than the benefits. Reduced personnel expense for data entry, paper and postage savings, and shortened receivable cycles are all quantifiable benefits, but the thousands to hundreds of thousands of dollars required to set up and maintain the implementation of traditional EDI needs to be justified with more significant benefits than these. For an EDI implementation to be successful, it needs to be the direct cause of improved productivity and internal operations, create closer customer vendor relations, provide a competitive advantage in the marketplace, and open up the procurement process. Historically this has not been the case for two reasons :The high cost involved with EDI, especially for small to medium-sized enterprises(SMEs), and what we refer to as standard issues. (Ref. Electronic commerce Nabil Adam, Oktay Dogramaci et al.) E-C applications in Supply-Chain and manufacturing Another area where EC applications facilitate improvement is supply chain management. The objective of an electronic commerce strategy is to provide purchasing managers with better control over their companies purchasing habits and relationships with suppliers Continuous improvement of an organizations supply-chain is directly related to its performance, and EC applications are being used in procurement processes more and more frequently to this end. ترتبط التغيرات في سلسلة التوريد ارتباطا وثيقا بعمليات البيع بالتجزئة بين الشركات. The advantages of EC in supply-chain management include access to a wide range of suppliers and effective use of organizational resources that are essential for implementing just-in-time (JIT) manufacturing systems..Ref. C Curtis Getting on to the e-Commerce supply chain Just in time Internet week Sept. 1997 These automated systems provide new types of information for businesses that implement them. Among the enhanced capabilities for managers are improved sales forecasts, more accurate balance sheets, and closer relationships with customers using a new interface. Direct communications between suppliers and customers streamlines the supply chain and delivers new relevant information to manufacturers in real-time. For one example of how businesses are accomplishing these goals, craig (in internet Week Nov. 1997) describes a joint venture between SAP and Digital Equipment Co. to keep vending machines filled to demand with a web-based EDI system. An embedded computer in the vending machines is connected to the internet, and each time a product is purchased a message is sent to the supplier. This gives suppliers crucial information about their distribution channels in real-time, and removes the requirement for vending machine operators to use non standard proprietary software that accomplished this task in the past. 11.2 ELECTRONIC DATA INTERCHANGE (EDI) (MR) (Source. EDI ebook, at editraining) Electronic Data Interchange or EDI is the electronic exchange of business documents from one companys computer to anothers computer in nationally standard structured data formats. Using EDI to exchange business documents eliminates the rekeying of the data, resulting in more accurate data. In EDI, data necessary for conducting business is transmitted directly into a system without human intervention. We can transmit and receive EDI documents with companies such as banks, railroads, customers and suppliers. The companies who send and receive EDI with are referred to as trading partners. For many years business data has been exchanged electronically on tapes, disks. diskettes and over direct computer to computer hookups. Companies realized replacing the paper used in business transactions with electronic communication saved both money and time Customers and suppliers were interested in sending and receiving electronic documents however, each company had different documents need and different computer and communication medium. The effort to maintain different document formats and different communications hookups became time consuming and costly. Electronic transactions started becoming standardize. Different standards for different industries still exist. The Accredited Standards Committee (ASC) X12 of the ANSI was created to support the national standards of EDI. Transaction sets (standard business transaction formats) are developed and maintained by the ASC X12. Most of Industries use subset of the X12 standards. Following are some major industries that use subsets. AFPA Paper Industry CIDX Chemical Industry WINS Warehouse Industry VICS Retail Industry UNEDIFACT Standards are used internationally. EDI Data Structure Individual electronic transmission between trading partners is grouped in an electronic envelope similar to putting paper documents into paper envelopes. The electronic envelope specifies who is sending and who is receiving the documents. Within each electronic envelope is a collection of documents of the same type, this is called a functional group. An example of the functional group is a collection of invoices. You can group several invoices together and send them in a functional group in EDI. Documents (purchase orders, invoices..) are referred to as transaction sets in ANSI X 12 standards and messages in UNEDIFACT standards. There are hundreds of document types defined by EDI standards. A document contains segments that are logical groups of information. Each segment is preceded by a segment identifier and terminated by a segment separator. A segment is made up of data elements. This is where the information is stored . How Does EDI Work EDI involves three functions within each computer system: 1) Application Interface System. 2) EDI Software 3) Communications Handler Application Interface System Processes the data to be sent to, or received from, the trading partner. Moves electronic transactions to or from the application system. Programs separate and deliver inbound transactions to the application systems. 4. Delivers inbound transactions to the applications systems and gathers transactions from the application systems for outbound transmission. EDI Software 1. Manipulates and routes data between the application system and the communications handler. 2. Translates Business documents into and out of the X12 formats. 3. Creates Functional Acknowledgments (EDI transaction that notifies the trading partner that an electronic document was received). 4. Verifies the identity of trading partners. 5. Validates the transactions by checking a master file against the information transmitted. Communications Handler Transmits data to and from the trading partner through a value-added network. Protects against transmission errors or interruptions. Example of EDI Process: This example shows the process of a shipment notice from the manufacturer to the customer. These are various steps involved in process: 1. The data is extracted from the shipment and database. 2. The data is translated by the EDI software into a standard X12 EDI shipment notice format. 3. The EDI shipment notice is transmitted through a Value Added Network (VAN) to the company. 4. The company receives the EDI shipment notice. 5. The EDI shipment notice is translated into a format that can be used to update the database of the company. (Source. Article by G. Berton Latamore, Apics, February 1999,No.2) Although EDI has been the traditional approach to automating business transactions between trading partners, e-commerce, using Java applets embedded in Internet-enabled applications, is coming on strong. E-commerce offers several advantages over EDI. The initial investment in technology is much less. For smaller companies with lower trading volumes, the internet costs much less than a VAN. Internet reaches everyone in the supply chain, supports near real-time messaging, and supports both machine-to-machine and human-to-machine transactions. EDI has advantages for larger manufacturers that must automate complex transactions among a large community of suppliers. It provides a standard way to format key transaction data and provides a complete set of messages, including acknowledgements. EDI also includes built-in security . while the Internet is still a very insecure environment. E-commerce sites focused on the supply chain have been designed to extend electronic commerce to supply chain members that have not invested in EDI, rather than replacing existing EDI sites. Most experts expect this pattern to continue and advise manufacturers with EDI systems to consider adding e-commerce front ends to allow smaller suppliers or customers to communicate directly with their existing infrastructure. However, experts caution that EDI and e-commerce are not necessarily antagonistic and agree most companies need a combination both to effectively reach their entire supply chain. Where EDI Excels Less expensive and easier to implement for simple transactions bteween two trading partners. However becomes expensive and complex when trying to support sets of complex transactions among large groups of trading partners. Provides a complete, integrated package to support transactions . including receipts showing that transactions were received e-commerce only provides a template from which each form must be created and each response programmed Supports near real-time transactions. Handles a much wider range of transaction types and can be used for any kind of transaction between trading partners. Provides a complete security package e-commerce has no built-in security and requires that a suite of separate security applications be custom integrated. Supports both machine-to-machine and man-to-machine transactions EDI only does machine-to-machine, making it an impractical answer for handling specialty or occasional orders. VANs are very secure the Internet, by design, is insecure . Reaches everyone over the Internet EDI only reaches trading partners who can afford connectivity to the VAN of choice. Optimized for large volumes of transactions processed on large servers or mainframes e-commerce is most successful in low-volume environments running on PCs or smaller servers. 12.3 Distribution and Transportation System ACQUISITION COSTS: these costs include the price of the items, the shopping time, the paper work, expediting (emergency buy, down time), mistakes (returns, rejects, quantity errors this will generate expediting costs), and the price for internal handling (receiving and storing). BREAK-BULK CARGO: Cargo, which is, shipped a unit (i. e. Palletized cargo, boxed Cargo, large machinery, trucks and pre-slung cargo). BULK CARGO: Loose cargo that is loaded directly into a ships hold. BULK CARRIER: There are two types of bulk carrier, the dry-bulk carrier and the liquid-bulk carrier better known as a tanker. Bulk cargo is a shipment such as oil, grain, or ore which is not packaged, bundled, bottled, or otherwise packed and is loaded without counting or marking. BUSINESS PROCESS (BP) : A set of logically related tasks performed to achieve a defined business outcome. CARRIER(S) CONTAINER(S)SHIPPER(S) CONTAINER(S): The term Carrier(s) Container(s) or Shipper(s) Container(s) means containers over which the carrier or the shipper has control either by ownership or by the acquisition thereof under lease or rental from container companies or container suppliers or from similar sources. Carriers are prohibited from purchasing, leasing or renting shipper owned containers. CHANGE ANALYSIS: Study of suitable changes of the activities of an enterprise in concrete situation CORRUGATED CASES: Built like a sandwich cardboard - characteristic arches of wavy fluting lying between two pieces of smooth board on the outside. CONTAINER: The term container means a single rigid, non-disposable dry cargo, insulated, temperature controlled flatrack, vehicle rack portable liquid tank, or open top container without wheels or bogies attached, having not less than 350 cubic feet capacity, having a closure or permanently hinged door that allows ready access to the cargo (closure or permanently hinged door not applicable to flatrack vehicle rack or portable liquid tank). CONTAINER SHIP: Ocean going ship designed to carry containers both internally and on deck. Some are self-sustaining. CONTAINERIZATION: Concept for the ultimate unitizing of cargo used by both steamship lines and air cargo lines. Containers allow a greater amount of cargo protection from weather, damage, and theft. DATA: Raw information representing events occurring in the organization before they are organized into an understandable and useful form for humans DATA DICTIONARY: A way of organizing information, which is collected. This information enables one to work out the composition of the data, uniqueness and consistency of names and definitions of terms, and document them in dictionary which all team members can use DATA FLOW: Data flow on context diagram either represents information produced within or outside the system which is used by outside world or by the system itself DATA FLOW DIAGRAM: An important technique for modeling high level detail in a process within a system. They highlight the functions of the system and how they use stored information and transfer information between each other. DATA-ORIENTED WORK: Refers to the development parts whose purpose is to design technical solutions to this specification. DISTRIBUTION CHANNELS: Methods by which distribution get products to market. EDI: Electronic Data Interchange Proprietary systems by which companies share information. END-USERS: Customers that are served by distribution. ENTITIES RELATIOINSHIP DIAGRAMS (ERD): A semantic modeling tool used to identify and organize information and to model particular roles of importance to the enterprise and relationships between them ENTITIES: A class of real world thing whose role of interaction with the enterprise is well defined. INFORMATION: A derivative from meaningful interpretation of data. INFORMATION SYSTEM: A set of interrelated components that collect (or retrieve), process, store and distribute information to support decision making and control in an organization. INFROMATION TECNOLOGY (IT) : This includes the capabilities offered by computers, Software and telecom. The current media by which information is transferred. HOLDING COSTS: are the interest costs, the storage cost, the control cost (shipping, transportation, security), taxes, insurance, and the shrinkage cost (shipped short or long, stolen, obsolescence). HUB: A central location to which traffic from many cities is directed and from which traffic is fed to other areas. MANAGEMENT INFORMATION SYSTEMS (MIS): A division in corporate structure that creates and maintains IS for the management levels of an organization. OFFICE AUTOMATION SYSTEMS (OAS): Serves the knowledge level of an organization. PALLET: Load carrying platform to which loose cargo is secured before placing aboard the aircraft. PERISHABLES: Any cargo that loses considerable value if it is delayed in transportation (Usually refers to fresh fruit and vegetables). PROBLEM-ORIENTED WORK: In information systems development, refers to the development parts whose purpose is to specify what the information systems will do. STRADIS (Structured Analysis And Design of Information Systems): follows the Top-down approach (functional decomposition) for analyzing processes. TOTAL PROCUREMENT COSTS: are the holding costs and the acquisition costs. TRANSACTION: A performance or management of a business. In the context of distribution, it is all the interactions between manufacturing, distribution and end-users. TRANSACTION PROCESSING SYSTEMS (TPS): Serves the operational level of an organization. UNITISATION: The packing of single or multiple consignments into ULDs or pallets. USER: One who would be accessing an IS interface in order to gain a knowledge, to apply to a decision making process.

No comments:

Post a Comment